KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0645Help
Entry
BLLJ_0645         CDS       T01419                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLLJ_0645
   01230 Biosynthesis of amino acids
    BLLJ_0645
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_0645
  Energy metabolism
   00680 Methane metabolism
    BLLJ_0645
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLLJ_0645
Enzymes [BR:blm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLLJ_0645
Exosome [BR:blm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLLJ_0645
  Exosomal proteins of melanoma cells
   BLLJ_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(813890..814588)
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSVFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKSLYVDRRPEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDRRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccgttttccttatccgtcatggacgtacctcctacaacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaagcctgtacgtcgatcgtcggccggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaagctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcgtcgcgtccgtgaacgcagcttcggtgat
tgggatggccatgccgtggccgaactggccgaacgctaccccgaggacttccgttcctgg
atggagtctcggggcggcgagctgaagtatggagccgagcccaaggaagctgtgggcaag
cgcggcgtggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggattgcgcagacattgcagaccctgttgggcatttctgca
atcgatccgaccttttccacggtggtttcattgcgtaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggaacgcgaacgctga

  All links  
No link information was found.   
DBGET integrated database retrieval system