KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0645Help
Entry
BLLJ_0645         CDS       T01419                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Brite
Enzymes [BR:blm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     BLLJ_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAJ66313
UniProt: E8MHR0
Position
complement(813890..814588)
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSVFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTAAALKSLYVDRRPEINH
RFIVCSDLKRAHATAQAFADVLGGIEPVDDRRVRERSFGDWDGHAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGVEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVRLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccgttttccttatccgtcatggacgtacctcctacaacgcc
gctcacaagctccaaggccaggtcgacattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccgcggccttgaaaagcctgtacgtcgatcgtcggccggaaatcaaccac
cggttcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaagctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcgtcgcgtccgtgaacgcagcttcggtgat
tgggatggccatgccgtggccgaactggccgaacgctaccccgaggacttccgttcctgg
atggagtctcggggcggcgagctgaagtatggagccgagcccaaggaagctgtgggcaag
cgcggcgtggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggattgcgcagacattgcagaccctgttgggcatttctgca
atcgatccgaccttttccacggtggtttcattgcgtaatgcgcactgggtgcgcttggtg
ccgatggacaatcccgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggaacgcgaacgctga

DBGET integrated database retrieval system