KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0722Help
Entry
BLLJ_0722         CDS       T01419                                 

Definition
amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    BLLJ_0722
Enzymes [BR:blm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     BLLJ_0722
    3.5.1.-  
     BLLJ_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(909373..909993)
Genome map
AA seq 206 aa AA seqDB search
MTMTKALIVVDVQPTFCESGELGVAGGNAVAERIADYVNAHRSEYAYIATTQDWHIEPGA
HWSAEPDFVDTWPKHGAAGTLNAELHPAIKALNIEHHFKKGQYSAAYSGFEGIEDNTDRI
QTREEVEAEQSAGKTLANALKAAGVSRVDVVGIAESHCVKDTALDAKKLGFEVTVFEDLT
VPVSEELGVAARKQMAAGGITLAESR
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaccaaggcactgattgtggtggatgtgcagccgacgttctgtgaaagcggc
gaactgggtgtcgcaggcggcaacgcggtcgccgagcggattgccgattatgtgaacgcg
catcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatcgagccgggcgcg
cactggtcggcggagccggatttcgtggacacgtggccgaagcatggtgcggccggcacg
ctgaacgccgaattgcatccggcgatcaaggcgctgaatatcgagcatcatttcaagaag
ggccagtattcggcggcatattccggttttgagggtatcgaggacaataccgaccgtatc
cagacccgcgaggaggtcgaggccgagcaatccgccggcaagacgctggccaacgcgctg
aaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcgcattgtgtcaag
gacaccgcgctcgatgccaagaagctcggcttcgaggtcaccgtgttcgaggatctgacc
gtgccggtcagcgaggaacttggtgttgcggcccgcaagcagatggctgcgggcggcatc
acattggctgagtcccgctga

DBGET integrated database retrieval system