KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0746Help
Entry
BLLJ_0746         CDS       T01419                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLLJ_0746
  Amino acid metabolism
   00300 Lysine biosynthesis
    BLLJ_0746
Enzymes [BR:blm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BLLJ_0746
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934421..935977
Genome map
AA seq 518 aa AA seqDB search
MTLTATERDLVDAASRWFDAHRAQFVDELCELLRYPSVSDESDPNPRPGAPYGPEVRRVF
DHMLAKAGRDGLPTRDYTGHVMEVVYPQENVETDRDIAFVDHLDVVPADDGWTHDAFDPQ
VIGDIVIGRGSLDNKGVALTSYFLLRFFKEHDHRFRHRVRILFGGSEEIALNDIKWFVAN
IGAPYQAIVTDGPFPVNNIQKGLLDVDVELPVGPQLRGWHAGTATNTVPGAAAITLTGVD
ESTVRQAFCQSGNIAPDIAERLHINATAQGVTIEATGVAGHACQPSGTVNAIAVLTTALA
RSGLLEGRDLTAAQAIAQWTKDSYGTGLGIDCENAESGPTTANGGLIIPANEFAEADKVL
GAVSGETSEDAIVLHFDIRYAVGQAHEQIIERIQAQAEAAGGRIVDILNDDPYYVQADDP
RVQLLTATYNDVLGCEARPVAVGDGTHARFIPRALNFGPEFHADHVPAVDGIDLETPPFI
APGAGNAHGADEWASLKNLKTAFVLYALGLVRLDQYLQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgactctcaccgccacggaacgtgatctcgtcgatgccgcgtcacgctggtttgacgcc
caccgcgcacagttcgtcgatgagctgtgtgagctgctgcgctacccgtcggtttccgac
gaatcggacccgaatcctcgtccgggcgcgccttatggacccgaagtacgccgtgtattc
gaccatatgctggccaaggcaggacgagacgggctgcctacgcgcgactacaccggccac
gtcatggaagtcgtttatccacaggagaacgtggagaccgaccgtgacatcgccttcgtc
gaccacctcgacgtagtccccgccgacgacggttggacgcacgatgccttcgatccgcag
gttattggcgatattgttatcggtcgcggctcattggacaataaaggcgtcgcgctgacc
agctatttcctactccgtttcttcaaggaacacgaccaccgtttccgccaccgcgtacgt
atactgttcggcggctccgaagagatcgcgctcaacgacatcaaatggttcgtcgccaac
atcggcgcgccgtaccaggccatcgtcaccgatggtcccttcccggtgaacaatatccaa
aaagggctgctcgatgtggatgtcgaactgccggtcgggccgcaattgcgcggttggcat
gccggcaccgccactaacacggttcccggggccgccgcaatcaccctcaccggcgtcgac
gaatctaccgtgcggcaagcattctgccagagcggcaacatcgctccagatatcgccgag
cgattgcatatcaacgcaacagcgcaaggcgtcacgattgaggccaccggtgtcgccggt
catgcctgccagccgtccggtaccgtaaacgctatagcggtgctcactacggcgcttgcc
cggtccggtctgctcgaaggccgtgacctcactgcagcgcaggcgattgcccaatggaca
aaagactcatatggcaccggcttgggtatcgattgcgagaatgcggaaagcggaccgact
accgccaatggtggtttgattataccggcgaatgagttcgctgaagcagacaaggtatta
ggcgcggtatcaggtgagacttctgaagatgccatcgtattgcacttcgacatccgttat
gcggtaggccaggcacacgaacaaatcatcgagcgtattcaagcacaagccgaagcggcg
ggcggccgcattgtcgacatccttaacgatgacccatactacgtgcaggctgacgacccg
cgtgtccagttgctcaccgcaacctacaacgacgtgctcggttgcgaggctcgacccgtg
gctgtcggcgacggcacccacgcccgctttatcccgcgcgcactcaacttcggtcccgaa
ttccatgccgaccatgtgccggcggtcgacggcatcgacctggagaccccgccattcatc
gcaccaggtgccggcaacgcgcacggtgccgatgaatgggcctcgctgaaaaacctgaaa
acagcgtttgtcctatatgcgttaggcctagtgcgtctcgaccaatacctgcaatag

DBGET integrated database retrieval system