KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0809Help
Entry
BLLJ_0809         CDS       T01419                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00010  Glycolysis / Gluconeogenesis
blm00071  Fatty acid degradation
blm00350  Tyrosine metabolism
blm00625  Chloroalkane and chloroalkene degradation
blm00626  Naphthalene degradation
blm01100  Metabolic pathways
blm01110  Biosynthesis of secondary metabolites
blm01120  Microbial metabolism in diverse environments
blm01130  Biosynthesis of antibiotics
blm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_0809
  Lipid metabolism
   00071 Fatty acid degradation
    BLLJ_0809
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLLJ_0809
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLLJ_0809
   00626 Naphthalene degradation
    BLLJ_0809
Enzymes [BR:blm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLLJ_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C Glu_dehyd_C MCH AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: BAJ66477
UniProt: E8MI74
Position
complement(1011477..1012424)
Genome map
AA seq 315 aa AA seqDB search
MKSWRFTGTNEPLQLAELPEPTAGPGQVVVDVKAAGICHTDVGILTDPGWMTMLAQVPVT
LGHEDAGVISQVGEGVDDFQVGDRVAICPTTPAGCPGSSFDGGFGPKIVVGTQALVRIPD
EVDFVNGAAATDAGMTSYAAVVRRGGVKAGDRVGIIGLGGLGQIGARVAHLLGAEVHVAE
IKEDIWPLAKELGAVDARQSITDYPKGFFDVIVDFAGFGDTTADAVDVIRLGGVVVLVGM
GRLETTIDAKSLIVNQCDLRGSNGGTPDDIRGVYELMRTGKLTPVTTTVSFDEVPEAIER
LERGDVVGRLVISYE
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatggagattcaccggcaccaatgaaccattgcagctcgccgagctgcccgag
ccgaccgccggaccggggcaggtcgtcgtcgacgtgaaggcggccggcatctgccacacc
gatgtgggcattctcaccgatccgggctggatgacgatgctggcgcaggtgccggtcacg
ctcggccacgaggatgccggcgtgatcagccaagtcggcgagggcgtggacgattttcag
gtgggcgaccgcgtggcgatatgcccgaccacgccggccggctgccccgggtcctccttc
gacggcggattcggcccgaagatcgtggtgggcacgcaggcgctggtgcgcattcccgac
gaggtggatttcgtcaacggcgccgcggccaccgatgcgggcatgacctcgtacgcggcc
gtggtgcgccgtggcggcgtgaaggccggcgacagggtcggcatcatcggattgggcggg
ttgggccagatcggcgcccgcgtggcccatctgctgggcgccgaggtgcatgtggcggag
atcaaggaggatatctggccgctggccaaggaactgggcgcggtggacgcgcgccagtcc
atcacggactatccgaagggattcttcgatgtgatcgtcgacttcgccggattcggcgac
accaccgccgacgcggtggacgtgatcaggctgggcggcgtggtggtgctcgtcggcatg
ggccggttggaaaccaccatcgatgccaagtcgctcatcgtcaaccagtgcgatctgcgc
ggatccaacggcggcacgcccgacgacatccgaggcgtctacgagctgatgcgcaccggc
aagctcacgccggtcaccacgaccgtctcgttcgacgaggtgccggaggcgatcgaacga
ctggagcgcggcgacgtggtcggccgtctggtcatcagctacgagtga

DBGET integrated database retrieval system