KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0819Help
Entry
BLLJ_0819         CDS       T01419                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:blm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:blm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1025124..1026104
Genome map
AA seq 326 aa AA seqDB search
MSEETPMVGKSVVTLDGLSTNQILDLLHKAEYIDSHRKEIAHTCDGRVLATLFYEPSTRT
RLSFETAMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVAS
RAASVPVINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLC
RFGNVRFVLISPDELKTPQYVIDRINATDSCSYVEVRDLASVIGDLDVLYMTRVQKERFF
NEDDYLRLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLV
RMALESTVVGDELPGYEPLNPKEVQA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgaagaaacgccaatggtcggcaaaagcgtcgtaacgctggacggcctgtctaca
aaccagattctcgacctgctgcataaggccgaatacatcgattcccaccgcaaagagatt
gcccatacctgcgatgggcgagtgctggccacgctgttctacgagccctccacccgtacg
cgcctgagctttgagaccgcaatgctacgtctcggcggcaaggtcatcggattcgccggc
gcgcagctggcctccgtgaccaagggcgaatccatcgccgacacgttgaagaccgtgtcc
aactacgtggacgtggtcgccatccgtcacccgaaggagggtgccgcgctggtggcctcc
cgcgccgcatccgtgccggtaatcaacgccggcgacggcggccacatgcaccccacgcag
acgctggccgacctggccacgctgcagtcgcgcttcggccgcatcaccgacctgaccgtg
ggactgtgcggcgatttgaccttcggccgcaccgtgcactccctgatcgagaccctgtgc
cgcttcggcaacgtgcgcttcgtgctcatcagcccggacgagctcaagaccccgcagtac
gtgatcgaccgcatcaacgccaccgacagctgctcctacgtggaagtgcgcgacctggcc
tccgtgatcggcgacctcgacgtgctgtacatgacccgcgtacagaaggaacgcttcttc
aacgaagacgactacctgcgcctgcgcgacacctacattctcgacgaagagaagctgcag
ctcgccaagccgtccatggccgtgcttcacccgctgccgcgcgtcaacgaaatcgccgtg
gacgtggacgacgacccgcgtgccgcctacttcgaacaggtcaagaacggcatgctcgtg
cgcatggccctcgaaagcaccgtggtgggcgacgaactgcccggatacgaaccgctcaac
cccaaggaggttcaggcctga

DBGET integrated database retrieval system