KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0863Help
Entry
BLLJ_0863         CDS       T01419                                 

Definition
tryptophan synthase beta subunit
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blm01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:blm00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:blm00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1062492..1064579
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRARELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAALAREYERGGASAISVLTEGRRFLGGLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELGMTVLVETHTREEIERARQAG
AKVIGINARNLKNLKVDVNKYNELAADLPDNVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDHELAVERLVKAGAQVKASETTPLSEHQGPYWGQFGGRYVPEALITALDELER
VYNEAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFAALVKEKTGLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRVIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQTEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVAGAHGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcgcccgtgagctc
accgtatcgcttgaggacgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtcc
ccgtccaagggccacctgtccgacatcccggacccggccgcgctggcccgcgagtacgag
aggggcggcgcaagcgccatctccgtgctcaccgaaggccgcagattcctcggcggcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccggtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaggcccgcgcccacggcgccgatctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcatctgctcgacctggcgcacgagctcggc
atgaccgtgctggtggagacgcacactcgcgaggagatcgaacgcgcacgccaggccgga
gccaaggtgatcggcatcaacgcgcgtaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgataacgtcatcaaggtggcggaatccggcgta
ttcggcgcggtcgaggtcgaagactacgcccgtgcgggagcggacgcggtactggtcggc
gagggcgtggccaccgccgatgatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacgaccccgctcagcgaacatcagggaccgtattggggc
cagttcggtggccgctatgtgcccgaggccctgatcaccgccctcgacgagcttgagcgc
gtctacaatgaggccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgcccgagcccgctgaccgaagccccgcgcttcgccgcactggtcaag
gagaagaccggtctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggt
gcgcacaagatcaacaacgcgctcggacaggccctgctcgtcaagcgcatgggcaagacc
cgcgtgatcgccgagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgctcggcctcaagtgccgcatctacatgggccagatcgacgcccgccgtcaggccctc
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgacccttggcgacaag
atcctgaaggacgccatcaacgaagccctgcgcgactgggtcaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcgggcccgcacccgttcccggccatggtgcgcgacttc
cagaagatcatcggcgaggaggccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgacgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggc
gccaagagctacctgctggaaaccgacgaaggccagacgctcgacacctactcgatttcc
gcaggcctcgactacgcttccgtgggccccgagcacgcatggctcaaggacattggccgc
gtgaactacagctgggccaccgacgaggaggccatgaacgccttccgcgacctgagccag
accgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaggcc
gccgccgatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggttcggttatctgaccgacgaccag
gccgccgcgctcgatgtggccggcgcccacggcaatactgtcgcctga

DBGET integrated database retrieval system