KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_0864Help
Entry
BLLJ_0864         CDS       T01419                                 

Definition
tryptophan synthase alpha subunit
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BLLJ_0864
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLLJ_0864
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BLLJ_0864
Enzymes [BR:blm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BLLJ_0864
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1064603..1065472
Genome map
AA seq 289 aa AA seqDB search
MTNEATTPSGQPLGISHKPSKSGAMFTKFKAENKPAFIGYLPYGFPNPDVSLDAFRTMVE
HGVDAVEIGLPYSDPVMDGPVIQAAASIALNNGETIKRVFEAVETVANAGGVPLIMSYWN
LVYHYGVERFAHDFENAGGAGLITPDLIPDEAGEWIEASDRHGLDRIFLVSPDSSTERLE
TVARNARGFVYAAARMGVTGERATIDASPELLVERTRQAGAENVCVGIGVSTAEQGAKVG
SYADGVIVGSALVHTLLADDNKTARDPKEGLKLLAAKSEELAEGIHNAR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatgaagcaaccacgccgtccggccagccgctgggcatcagccacaagcccagc
aagtcgggcgctatgttcaccaagttcaaggccgagaacaagcccgccttcatcggctac
ctgccctacggcttccctaacccggacgtctcgcttgacgccttcaggacgatggtcgag
cacggcgtcgacgccgtggaaatcggcctgccgtactccgacccggtcatggacggcccg
gtcatccaggctgccgcctccatcgccctgaacaacggcgagaccatcaagcgcgtgttc
gaggccgtcgaaaccgtggccaacgccggcggcgtgccgctcatcatgagctactggaac
ctcgtgtaccactacggcgtcgagcgcttcgcccacgacttcgagaacgccggtggcgcc
ggtctcatcaccccggaccttatcccggacgaggcgggggagtggatcgaagcctccgac
cgccacggactcgaccgcatcttcctggtctccccggactcgtccaccgagcgcctcgaa
accgtggcccgcaacgcacgtggcttcgtgtacgcggccgcccgcatgggcgtcaccggc
gaacgcgccaccatcgacgcctcgcccgaactcctcgtggaacgtacccgtcaggccggt
gccgagaacgtgtgcgtgggcatcggcgtgtccaccgccgaacagggcgccaaggtcggc
tcctacgcggacggcgtcatcgtcggctccgcgctcgtgcacaccctgctcgcggacgac
aacaagaccgcacgcgacccgaaggaaggcttgaagctgctcgccgccaagagcgaggaa
ctggccgaaggcatccacaacgcccggtaa

DBGET integrated database retrieval system