KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1074Help
Entry
BLLJ_1074         CDS       T01419                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BLLJ_1074
   00052 Galactose metabolism
    BLLJ_1074
   00500 Starch and sucrose metabolism
    BLLJ_1074
   00520 Amino sugar and nucleotide sugar metabolism
    BLLJ_1074
Enzymes [BR:blm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BLLJ_1074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1252249..1253778)
Genome map
AA seq 509 aa AA seqDB search
MTEINDKAQLDIAAADDTDAVTSDTPEETVNTPEVDETFELSAAKMREHGMSETAINQFH
HLYDVWRHEEASSWIREDDIEPLGHVPSFHDVYETINHDKAVDAFAKTAFLKLNGGLGTS
MGLDKAKSLLPVRRHKAKQMRFIDIIIGQVLTARTRLNVELPLTFMNSFHTSADTMKALK
HHRKFSQHDVPMEIIQHQEPKLVAATGEPVSYPMNPELEWCPPGHGDLFSTIWESGLLDV
LEERGFKYLFISNSDNLGARPSRTLAQHFENTGAPFMAEVAIRTKADRKGGHIVRDKATG
RLILREMSQVHPDDKEAAQDIAKHPYFNTNSIWIRIDALKDKLAECDGVLPLPVIRNKKT
VNPTDPNSEQVIQLETAMGAAIGLFNGSICVQVDRMRFLPVKTTNDLFIMRSDRFHLTDT
YEMEDGNYIFPNVELDPRYYKNIRDFDERFPYAVPSLAAANSVSIQGDWTFGRDVMMFAD
AKLEDKGEPSYVPNGEYVGPQGIEPDDWV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaaataaacgataaggcccaactggatatcgccgccgctgacgacaccgacgcc
gtcacctcggacacccccgaagaaaccgtaaacacccccgaagtggatgagactttcgag
ctttcggccgccaagatgcgcgagcacggcatgagcgaaaccgccatcaaccagttccac
catttgtatgacgtatggcgccatgaagaagcctccagctggattcgtgaggacgacatc
gagccgcttggccacgtgcccagcttccacgacgtctatgagaccatcaaccacgacaag
gccgtggacgccttcgccaagaccgcattcctcaagctcaatggcggtctgggcacctcc
atgggattagacaaggccaagtcgctgttgccggtgcgtaggcacaaggccaagcagatg
cgcttcatcgacatcatcatcggtcaggtgcttaccgctcgcacccgcctgaacgtcgaa
ctgccgctgacgttcatgaactccttccacacttcggcggacacgatgaaggcgctcaag
catcatcgcaagttcagccagcatgacgtgccgatggaaatcatccagcatcaggaaccc
aaactcgtggccgccaccggcgaaccggtgagctaccccatgaacccggagctggaatgg
tgcccgcccggccacggcgacctgttctccaccatctgggagtccggcctgcttgacgta
ttggaggagcgcggcttcaagtacctgttcatctccaattccgacaatctcggtgcacgc
ccctcgcgtacgttggcccagcacttcgaaaacacaggtgccccgtttatggctgaagtg
gccatccgcaccaaggccgatcgcaagggaggccatatcgtgcgagacaaggccactggt
cgcctgatcctgcgtgaaatgagccaggtccatccggatgataaggaagcggcccaagac
atcgccaagcatccttacttcaacaccaactcgatctggattcgcatcgacgctttgaaa
gacaagctcgccgaatgcgatggtgtgttgccgttgccggtgattcgtaacaaaaagacc
gtgaatcccacggacccgaactccgaacaggtgattcagctggaaaccgccatgggtgcc
gcaatcggtctgttcaacggttccatctgcgtccaagtggatcgtatgcgcttccttccg
gtgaaaaccaccaatgatttgttcattatgcgttccgatcgcttccacctgacggacacg
tatgagatggaagacggcaattacatcttcccgaacgtcgaacttgatccgcgatactac
aagaacatccgcgatttcgacgaacggttcccctacgccgtgccatctttggccgcagcc
aactcggtttccattcagggcgactggacattcggacgtgacgtcatgatgttcgccgac
gccaaacttgaagataaaggcgagccaagctatgtgccgaacggcgaatacgttggtccg
caaggcatcgaaccggacgattgggtgtga

DBGET integrated database retrieval system