KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1081Help
Entry
BLLJ_1081         CDS       T01419                                 

Definition
succinyl-CoA synthase beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLLJ_1081
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BLLJ_1081
   00640 Propanoate metabolism
    BLLJ_1081
   00660 C5-Branched dibasic acid metabolism
    BLLJ_1081
Enzymes [BR:blm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BLLJ_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1262435..1263637)
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPDAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALGDFDLAAATEMAQSIGFYHADVDQAAQILLKMWRCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNASFRHDGWARFVDPIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGTNIKPANFLDIGGGASAA
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILASANNPNIHVSETMEGAAAKAAQLAGEATQSKEVR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaataccaggcgcgtcagctgctcgaggaacaggacattcccaccccg
gacgccatctttgcccagaactcccatgaagtcgcagaagcggcggacaaaatcggctat
ccctgcgtaatcaaggcgcaggtcaagatcggtcatcgtggtcaggccggcggcgtcaag
atcgcccataaccgcgacgaggcgattcttgaatccgagtccatcctgccgatgaccatc
cacgggcacaaggtttccggcgtgcttgtagccgaagccaagaacatcctgcacgaatac
tacgtgtccatctccgtggaccgcacctcgcgcgacttcgacgtgctggccaccgctaac
ggcggcaccgaagtcgaggaaatcgccaaggaacatccggaggccgtcaagcgcctgcac
atcgatgcgctcggtgacttcgacctggccgctgccaccgaaatggcacagagcatcggc
ttctaccacgcggacgtcgatcaggccgcacagattctgctcaagatgtggcgctgcttc
aaagacaacgacgccacgctcgtggaaatcaatccgctcgccaagatcggcgacccggat
gacgaatccaccaagcagctgagcgccttggacgccaagatctccttggatgacaacgcc
tccttccgccatgacggctgggcgcgtttcgtggatcccatcgttcccgaccccttcgaa
cagcgcgcccgcgaacacggcctgcactacgtgcacctgcacggcgaggtcggtgtgatc
ggcaacggtgcaggactcgtcatgagttccctggatgccgtctccggcgctggcgaggaa
cagggcaccaacatcaagcccgccaacttcctggacatcggcggcggcgcctccgcagcc
gtcatggccgaaagcctggagatcgtactgtccgaccctcaggtcgaatccgtgttcatc
aatgtctatggcggcatcacctcctgcgtggaagtcgccaacggcatcctcgaagcggtc
gccaagctcggcggttccaagccgatcgttgtgcgcttcgatggcaacgccgccgccgag
ggcctgcatatcctcgcctccgccaataacccgaatatccatgtgtccgaaaccatggaa
ggcgcggcagccaaggccgcgcagctcgccggtgaggcgacccagtccaaggaggttcgc
tga

DBGET integrated database retrieval system