KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1103Help
Entry
BLLJ_1103         CDS       T01419                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BLLJ_1103
   01230 Biosynthesis of amino acids
    BLLJ_1103
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_1103
   00051 Fructose and mannose metabolism
    BLLJ_1103
   00562 Inositol phosphate metabolism
    BLLJ_1103
Enzymes [BR:blm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BLLJ_1103
Exosome [BR:blm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BLLJ_1103
  Exosomal proteins of bladder cancer cells
   BLLJ_1103
  Exosomal proteins of melanoma cells
   BLLJ_1103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1287352..1288155)
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVLAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAKLIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSIRILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSTKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttt
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtgcaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgctcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccaaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacttttggcacgaaggtatccgatagcatacgtatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccctggacgttgaggaactcgccaaaatcgctcgactggcactg
aaatccacgaaatcacggaactaa

DBGET integrated database retrieval system