KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1303Help
Entry
BLLJ_1303         CDS       T01419                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:blm01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:blm00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1530141..1531538)
Genome map
AA seq 465 aa AA seqDB search
MSENIMRIIDLRGQNLSRAELLAAMPRAAMGTSEATDLVRPILDDVKERGAAALRDFEEK
FDHVRPKNLRVPVEAIKDALTTLDPEVRAAIEESVRRARAVAANQVPKDFYTDLAEGARV
AERWIPIQRVGLYVPGGKAVYPSSVIMNAVPAQAAGVESLAIATPPARDNEEGLPNKTIL
ATCAILGVDEVYAVGGAQAIAMFAYGAKGSEPQDGDILCDPVDKITGPGNIFVATAKSLV
SAFVGIDAVAGPTEIGIIADETANPSLLAADLIGQAEHDELAGSVLFTDSTEIADKVQES
LKYRVPRTEHAERVHTSLSGTQSAIVLTGGLDQSIDAANAYAAEHLEIQTKDADAVVKRI
KNAGAIFRGPYSPVPLGDYMSGSNHVLPTGGTARFAAGLGVHTFMKPVEVIEYDEEGLKA
LAARINAFAVSEDLPAHGECVLSRFVKDPYDKATLREQEKEAGLR
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacatcatgcgaatcattgacctgcgtggtcagaacctgtcccgtgccgaa
ctgcttgccgcgatgccgcgtgctgcaatgggtacttccgaagccaccgatttggtgcgt
ccgattctggacgatgtcaaagaacgcggcgccgctgccctgcgcgacttcgaggagaag
ttcgatcacgtgcgtcccaagaacctgcgcgtgccggtcgaggcgatcaaggacgccctg
accacgctcgaccccgaagtgcgcgccgccatcgaggaatcggtgcgccgcgcccgcgcc
gtggccgccaaccaggtgccgaaggacttctacaccgacctcgccgaaggcgcccgcgtg
gccgaacgctggattccgattcagcgcgtcggcctgtatgtgcccggcggcaaggccgtc
tacccgagctccgtcatcatgaacgctgtgccggcccaggccgccggcgtcgaatcgctg
gccatcgccaccccgcccgcccgcgacaatgaggaaggcctgccgaacaagaccatcctc
gccacctgcgccatcctcggtgttgacgaggtatacgcggtcggcggcgctcaggccatt
gccatgttcgcatacggcgccaagggcagcgagccgcaggacggcgacatcctgtgcgat
ccggttgacaagatcaccggcccgggcaacatcttcgtggccaccgccaagtcgctggtc
tccgcattcgtgggcattgacgcggttgccggccccaccgaaatcggcatcatcgccgac
gaaaccgccaacccgagcctgctggccgccgacctcatcggccaggccgagcacgatgag
ctcgccggttccgtgctgttcaccgactccaccgagattgccgacaaggtgcaggagagc
ctcaagtaccgcgtgccgcgtaccgagcacgccgagcgtgtccacacgtcgctgtccggc
acccagtctgccatcgtgctgaccggcggtctcgaccagtccatcgacgcggccaacgcc
tacgccgccgaacaccttgagattcagaccaaggatgccgatgcggtcgtcaagcgcatc
aagaacgccggtgccatcttccgcggtccgtactccccggtgccgctgggcgactacatg
tccggctccaaccacgtgctgcccaccggcggcaccgcccgcttcgccgcaggcctcggc
gtgcacaccttcatgaagccggtcgaagtcatcgaatacgacgaggaaggcctcaaggcc
ctcgccgcccgcatcaacgccttcgcggtatccgaggacctgcccgcccacggcgagtgc
gtgctctcccgcttcgtcaaggatccgtatgacaaggccaccctgcgcgagcaggagaag
gaagccggtctgcgatga

DBGET integrated database retrieval system