KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1376Help
Entry
BLLJ_1376         CDS       T01419                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:blm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1625485..1626075)
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLT
EDEFLAREAAGEFLETAVVHGMAHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgctggccgtctaatcgtcctgactggccccaccgcagtaggt
aagggcaccgtggaagccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtctcc
gccaccacacgcgctccgcgcccgggcgaggttgatggcgtcaactattggttccttact
gaagacgagttcctggcccgcgaagcggccggtgagttcctggaaaccgccgtggtgcac
ggcatggcccactacggtacattgctcaagcctgtggaggaacatctggccgccggtgtg
cccacgattctggaaatcgacctgcagggtgcccgccgcgtcaagcagcgcgccgccgag
ctcgacctcgaagtggtgtacgtgttcatcgcgccgccaagcttcgaagagctcgagcgc
cgcctgatcggccgcggcaccgaaaccgccgaacagcaggcccgtcgcttggagaccgcc
aaggtggagctcgccgccgaaagcgaattcgacgtcaccatcgtcaacgaaaccgtcgat
caggccgctgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system