KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1402Help
Entry
BLLJ_1402         CDS       T01419                                 

Definition
glucokinase
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:blm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:blm00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:blm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1659387..1660154)
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgcacaggctttcggtgttgacattggcggttccggcatcaaggccgca
cctgtcgatctgaccaagggcgatttcgccgagccacgattgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgctttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaaccttgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtaaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatttacaacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aatgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gagaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgatcgtgcccgccaagctgcgtaaccag
gccggcatcgtcggtgccgcctactatgccagcaccaagcagcagtga

DBGET integrated database retrieval system