KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1489Help
Entry
BLLJ_1489         CDS       T01419                                 

Definition
(GenBank) sugar kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BLLJ_1489
Enzymes [BR:blm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BLLJ_1489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase XdhC_C NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAJ67156
UniProt: E8MEM9
Position
complement(1773675..1774643)
Genome map
AA seq 322 aa AA seqDB search
MSASCLDLLDHLHGSVSVVGSMNVDYTVVTERLPKPGETVNGGPLTLLPGGKSANQASAA
ARIGAQVRMFGAVGEDANADFLLEHLRDAGVDTSHIAAVAGPSGTTVITVDANGENTIVY
SAGSNGEVSVDYVRQSSDALVAADVLGLCLESPMETVTACARLCHDAGLKVLLNDSPFVA
ELPAELIEASDILLVNEHEMAQLLDIAEPDDDDWDGLDWSDVARQMHDFGFNQAVITLGG
DGSVVIDGDDIYRIAPVAVAAIDTTGCGDAFMGTVLAGLASGHALADSAQLASYVSAYAA
TGVGAQASYGTAAQIRERFGAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcatcatgtcttgacttgctcgaccacctgcacggcagtgtgtccgtggtcgga
tcaatgaatgttgattacacggtcgttactgagcggttgccgaaaccgggagagaccgtc
aacggtggcccgctgaccttattgccgggaggcaaatcagcgaatcaggcgtcggcggct
gcgcgaattggagcgcaggtgcggatgtttggtgcagtcggggaagatgccaatgcggat
tttctgctggagcatttgcgcgatgctggtgtggatacttcgcatatcgctgccgttgca
ggtcccagtggcactacggtaattaccgtggacgcgaatggtgagaacaccatcgtatat
tcggctggttccaatggtgaggtgtctgtcgactatgtgcgccagtcatctgacgcattg
gttgccgccgatgtgctgggactgtgtttggagagtccgatggaaacggtcacggcatgc
gctcgcctctgccatgatgccgggctcaaggtattgctcaacgattcgccattcgttgct
gaactacccgctgaacttatcgaggcttcggacattctgctggtcaatgaacatgaaatg
gcacagctgctggacatcgccgagcctgacgatgacgattgggatggactggactggtct
gatgtggcgcggcagatgcatgacttcggctttaatcaggcggtaattacgcttggcggg
gatgggtcggtggtcatcgatggtgatgatatctatcgtattgcgccagttgcggttgcg
gccatcgacactaccgggtgcggagatgcctttatgggcacggttctggccggacttgcc
tcgggtcatgcgttggcggacagcgcgcagttggcctcgtacgtttccgcgtacgccgcg
actggggtcggtgcgcaagcctcttatggtactgccgctcagattcgtgagcggtttggt
gcgaagtaa

DBGET integrated database retrieval system