KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1503Help
Entry
BLLJ_1503         CDS       T01419                                 

Definition
truncated glycoside hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    BLLJ_1503
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    BLLJ_1503
Enzymes [BR:blm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     BLLJ_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1790871..1791191)
Genome map
AA seq 106 aa AA seqDB search
MVGWPGSRQNSLFTITADTHEVRHNPEYYVMRHFSKYVRPGAKVLGTTSHFNSMAIAFRN
PDGTIVVVTQNALEDERPFEFADPADASRGFKATLAPRSFNTFVIE
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggctggccggggtcgcgccagaactccctgttcaccatcaccgccgacacgcac
gaggtgcgccacaaccccgaatactacgtgatgcgccacttctccaagtacgtgcgcccc
ggcgcgaaggtgctcggcaccaccagccacttcaactccatggccatcgccttccgcaac
ccggacggcaccatcgtggtcgtgacccagaacgcgctggaggacgaacgcccgttcgag
ttcgccgacccggccgacgcctcccgtggcttcaaggccacgctcgccccgcgctccttc
aacaccttcgtcatcgagtga

DBGET integrated database retrieval system