KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1572Help
Entry
BLLJ_1572         CDS       T01419                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00010  Glycolysis / Gluconeogenesis
blm00052  Galactose metabolism
blm00500  Starch and sucrose metabolism
blm00520  Amino sugar and nucleotide sugar metabolism
blm00521  Streptomycin biosynthesis
blm01100  Metabolic pathways
blm01110  Biosynthesis of secondary metabolites
blm01120  Microbial metabolism in diverse environments
blm01130  Biosynthesis of antibiotics
blm01200  Carbon metabolism
Module
blm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_1572
   00052 Galactose metabolism
    BLLJ_1572
   00500 Starch and sucrose metabolism
    BLLJ_1572
   00520 Amino sugar and nucleotide sugar metabolism
    BLLJ_1572
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLLJ_1572
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BLLJ_1572
Enzymes [BR:blm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BLLJ_1572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Glucokinase FtsA BcrAD_BadFG FGGY_N Hydant_A_N
Motif
Other DBs
NCBI-ProteinID: BAJ67239
UniProt: E8MEW2
Position
complement(1874685..1875635)
Genome map
AA seq 316 aa AA seqDB search
MTTLAIDIGGTKIAAAVCDENDSIIQRWRVPTPMDADAINQHIAEVYREAVAAGHTDIEA
IGISAAGNVSADRKTLTFSANIPAWINYDLSEHVGALIDHAVPVVVENDANCAGWGEYVH
GAGQGSSNMVALTVGTGLGGAIVINGQLYRGSFGMAAELGHLPMVPDGDHCGCGLRGCAE
RYTSGTSLENFAKSAVRRRPQDAKRLMELCGGDISKLEGPMVSQAAQEGDVLGLYAFGKI
GEWLGRTMAAVSAVLDPDLFVIGGGVVAVGDILLEPARYNYQRFLEGSAYRGHAKIVAAT
AGQDAGLIGAANLALR
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcgccattgatatcggaggaactaagatcgccgccgccgtctgcgatgaa
aacgatagcatcatccagcgctggcgcgtccccacgccgatggatgccgacgccatcaac
cagcacatcgccgaggtgtaccgcgaggctgtggccgccggacacaccgatatcgaggcc
atcggcatctccgccgccggcaacgtgagcgccgaccgcaagacgctcaccttctccgcc
aacatcccggcctggatcaactacgacctgtccgagcacgtcggcgcgctgatcgaccat
gccgtgccggtcgttgtcgagaacgacgccaactgcgccggctggggcgaatacgtgcac
ggtgccggccagggcagctccaacatggtcgccctgaccgtgggcaccggcctcggcggc
gccatcgtgatcaacggtcagctgtaccgcggctccttcggcatggccgccgaactcggc
cacctgccgatggtcccggacggcgaccactgcggctgcggcctgcgcggctgcgccgag
cgctacacctcgggcacttcgctggagaacttcgccaagtccgccgtgcgccgtcgtccg
caggatgccaagcgtctcatggagctgtgtggcggcgacatctccaagctggaaggcccg
atggtctcccaggccgcccaggaaggcgacgtgctcggcctgtacgcattcggcaagatc
ggcgaatggcttggccgcacgatggccgcagtctccgccgtgctcgatccggacctgttt
gtgatcggcggcggtgtggtggccgtcggcgacattctgctggagccggcccgctacaac
taccagcgtttcctggaaggcagcgcctaccgcggccatgccaagatcgtcgccgccacc
gccggccaagacgccggcctcatcggtgccgccaacctggctctgcgctga

DBGET integrated database retrieval system