KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1577Help
Entry
BLLJ_1577         CDS       T01419                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1881598..1882473)
Genome map
AA seq 291 aa AA seqDB search
MTDLQALHDATHTMVMGVLNITEDSFSDGGLWLDPAKAAQHGRDMMAAGADIIDIGAEST
RPGAKRVSEADELARITGAVKTLIPAGAVLSIDTTRASVAAAALSEGAQIINDVSGGTLD
AELPHVVADHDCLYVVQHWRGWLVGSKGANPDQDTSVYEHGVLTDVHDELMRQVDGVLAA
GVKPERIIIDPGLGFSKPGIEHNLPLLTGLETFRATGYPVLIGQSRKRFISAMLTGAGTA
GADGPTMAQRDDVTAALSALSAEHGAWAVRVHDVAKSRAAVIAGNTWREYA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgactgatttgcaggcgttgcatgacgccacgcacaccatggtgatgggtgtgctcaac
atcaccgaggactcgttctcggacggcggcctatggctggacccggccaaggcggcccag
cacgggcgcgacatgatggccgccggcgcggatatcatcgacatcggcgccgaatccacg
cgccccggtgccaagcgcgtgtccgaggccgacgaactggcccgtatcaccggtgccgtc
aagacgttgattccggccggtgccgtactgtccatcgacaccacgcgcgcatccgtggcc
gccgccgcgctgagcgagggcgcacagatcatcaacgatgtttccggcggcacgctggac
gccgagctgccgcatgtggtcgccgaccacgactgcctgtacgtcgtgcagcattggcgc
ggctggctcgtcggctccaagggcgcgaaccccgatcaagacacctccgtatacgagcat
ggcgtattgaccgacgtgcacgacgaactcatgcgccaagtcgacggcgtgctggccgcc
ggcgtaaagcctgagcgcattatcatcgatcctggtctgggcttctccaagcccggcatc
gagcataacctaccgctgctgaccgggctcgagaccttccgcgccactggatatccggtg
ctgattggccagtcccgcaagcgcttcatttcggcgatgcttaccggggcgggtactgcc
ggtgctgatggcccgaccatggcccagcgcgatgacgtgaccgcagccttgtccgccctg
tccgccgagcacggcgcatgggccgtgcgcgtacacgatgtggccaaaagccgcgccgcc
gtcatcgccggcaacacctggcgcgaatacgcatga

DBGET integrated database retrieval system