KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1578Help
Entry
BLLJ_1578         CDS       T01419                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:blm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1882561..1883160)
Genome map
AA seq 199 aa AA seqDB search
MNEYIESCQREKRTYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQA
SPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARL
VEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVR
GLLRNPATRAEAMSLILDK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatatatagagtcttgccagcgggagaaacgcacatacgacgaggaaggcgtg
cgcgaggccgtacgtctgttcctgaagtcgattggcgaggatcccgagcgcgagggactg
gtggaaacgcctgaccgtatcgcccgcgcgtgccgcgagctgttcgccggtctgcaggcc
tcgccggccgatgtgctggagaagcacttcgacgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtgtgcgagcatcacctgctgcctttccatggcgtggcc
catgtgggctacattcccgccaaggatggggtgatggggctgagcaagctcgcccgactg
gttgaggtgtatgctcgccggccgcaggtgcaggagcgtttgacccagcagatcgccgac
gcgctggtcgagtatgcgggcgcacgtggtgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgcggcatcaagaagtcttccgcccgcacggtgacctctgcggtgcgc
ggtctgctacgcaaccccgccacccgagccgaagccatgagtctgattcttgacaagtga

DBGET integrated database retrieval system