KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1578Help
Entry
BLLJ_1578         CDS       T01419                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
blm00790  Folate biosynthesis
blm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BLLJ_1578
Enzymes [BR:blm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BLLJ_1578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: BAJ67245
UniProt: E8MEW8
Position
complement(1882561..1883160)
Genome map
AA seq 199 aa AA seqDB search
MNEYIESCQREKRTYDEEGVREAVRLFLKSIGEDPEREGLVETPDRIARACRELFAGLQA
SPADVLEKHFDVDTDELVLVKDIELYSVCEHHLLPFHGVAHVGYIPAKDGVMGLSKLARL
VEVYARRPQVQERLTQQIADALVEYAGARGVIVVTECEHLCMSMRGIKKSSARTVTSAVR
GLLRNPATRAEAMSLILDK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaatatatagagtcttgccagcgggagaaacgcacatacgacgaggaaggcgtg
cgcgaggccgtacgtctgttcctgaagtcgattggcgaggatcccgagcgcgagggactg
gtggaaacgcctgaccgtatcgcccgcgcgtgccgcgagctgttcgccggtctgcaggcc
tcgccggccgatgtgctggagaagcacttcgacgtggataccgacgagctggtgctggtc
aaggacatcgaactgtattcggtgtgcgagcatcacctgctgcctttccatggcgtggcc
catgtgggctacattcccgccaaggatggggtgatggggctgagcaagctcgcccgactg
gttgaggtgtatgctcgccggccgcaggtgcaggagcgtttgacccagcagatcgccgac
gcgctggtcgagtatgcgggcgcacgtggtgtgattgtggtgaccgaatgcgagcacctg
tgcatgtcgatgcgcggcatcaagaagtcttccgcccgcacggtgacctctgcggtgcgc
ggtctgctacgcaaccccgccacccgagccgaagccatgagtctgattcttgacaagtga

DBGET integrated database retrieval system