KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1684Help
Entry
BLLJ_1684         CDS       T01419                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BLLJ_1684
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLLJ_1684
   00620 Pyruvate metabolism
    BLLJ_1684
   00650 Butanoate metabolism
    BLLJ_1684
  Lipid metabolism
   00071 Fatty acid degradation
    BLLJ_1684
  Amino acid metabolism
   00350 Tyrosine metabolism
    BLLJ_1684
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BLLJ_1684
   00626 Naphthalene degradation
    BLLJ_1684
Enzymes [BR:blm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BLLJ_1684
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BLLJ_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1995077..1997806)
Genome map
AA seq 909 aa AA seqDB search
MAEAKKKVEATKPTPEEKQAAAEAEVDALVARAKKALVEFENLDQKQVDRIVAKASIAAL
NKHLVLAKMAVDETGRGLVEDKATKNIFACEHVTNYLAGQKTVGIIREDDVMGIDEVAEP
VGVVAGVTPVTNPTSTAIFKSLIALKTRCPIVFGFHPGAQKCSVEAAKIVRDAAIEAGAP
ENCIQWIEHPSIQATGALMKHPGVATILATGGPGMVKAAYSSGKPALGVGAGNAPAYVDT
DVDIVRAANDLVLSKHFDYGMICATEQAIIAHKDVYDQLIKELKVRKAYFVNAEEKAKLE
QYMFGCTAGSGVKPVLNSAVPGKSPQFIAKAAGFEIPSDATILAAECKEVSDDEPLTHEK
LAPVQAVLKADNKEQAFEMCEKMLKLGAGHTAAIHTNNQELVREYGVRMHACRIIWNQPS
SLGGIGDIYNAIAPSLTLGCGSYGGNSVSGNVQAVNLVNIKRIARRNNNMQWFKIPAKTY
FEPNAIKYLRDMYGIEKAVIVCDKVMEQLGIVDKIIDQLRARSNRVTFRIIDYVEPEPSV
ETVEKGAEMMREEFEPDTIIAVGGGSPMDASKIMWLLYEHPEIAFSDVREKFFDIRKRAF
KIPPLGKKAKLVCIPTSSGTGSEVTPFAVITDHKTGYKYPITDYALTPSVAIVDPVLART
QPRKLASDAGFDALTHSMEAYVSVYANDFTDGMALHAAKLIWDNLAESVNGEPGLAKTNA
QEKMHNAATMAGMAFGSAFLGMCHGMAHTIGALCHIAHGRTNSILLPYVIRYNGQIPEEP
TSWPKYNKYIAPERYQDIARNLGIDTGKTPAEAVENLAKAVEDYRDNKLGMNKSFQDCGV
DEDYFWSVLDQIGMRAYEDQCTPANPRIPLINDMKDIAVGAYYGVSQAEGHKLRIEREGE
AATEEASER
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaagcaaagaagaaggtcgaagctaccaagccgactccagaagagaagcaggcc
gcagctgaggccgaagttgacgcgctggttgcccgcgccaagaaggctctcgtcgaattc
gagaacctcgaccagaagcaagttgatcgtatcgtcgccaaggcctccatcgccgctctg
aacaagcacctcgttctcgccaagatggctgtcgacgagaccggccgtggtctcgtggaa
gacaaggccaccaagaacatcttcgcctgcgagcacgtcaccaactacttggccggccag
aagaccgtcggcatcatccgcgaagacgatgtgatgggcatcgatgaggtcgccgagccc
gtcggcgtggtcgccggcgtcaccccggtcaccaacccgacctccaccgccatcttcaag
tccctcatcgccctgaagacccgttgcccgatcgtcttcggcttccaccccggcgcgcag
aagtgctccgtcgaggccgccaagattgtgcgcgacgccgccatcgaagccggtgctccc
gagaactgtatccagtggatcgagcacccgtccatccaggccacaggcgccctgatgaag
catccgggcgtggccacgatcctcgccaccggtggtccgggcatggtcaaggccgcttac
tcctccggcaagcccgccctcggcgtgggtgccggcaacgccccggcctacgttgacacc
gatgttgacatcgtgcgcgccgccaacgatctggtgctctccaagcacttcgattacggc
atgatctgcgccaccgagcaggccatcatcgcccacaaggacgtctacgaccagctcatc
aaggagctcaaggtccgtaaggcctacttcgtcaacgccgaagagaaggccaagctggaa
cagtacatgttcggctgcactgccggttccggcgtcaagcccgtgctgaactccgcggtg
ccaggcaagtccccgcagttcatcgccaaggctgctggcttcgagattccgtccgacgcc
accattctggccgccgagtgcaaggaagtctccgacgacgagcctctgacccacgagaag
ctcgctccggtgcaggccgtgctcaaggccgacaacaaggagcaggccttcgagatgtgc
gagaagatgctcaagctgggtgccggccacaccgccgccatccacaccaacaaccaggag
ctcgtgcgtgagtacggcgtccgtatgcacgcctgccgcatcatctggaaccagccttcc
tcccttggcggcatcggcgacatctacaacgccatcgccccgtcgctgaccctgggctgc
ggctcctacggcggcaactcggtgtccggcaacgtgcaggccgtgaatctcgttaacatc
aagcgcattgctcggaggaacaacaacatgcagtggttcaagatcccggccaagacctac
ttcgagccgaacgccatcaagtacctgcgcgacatgtacggcatcgagaaggccgtcatc
gtgtgcgataaggtcatggagcagctcggcattgttgacaagatcatcgaccagctgcgc
gcccgctccaaccgtgtgaccttccgcatcatcgactacgtcgagccggagccctccgtc
gagaccgtcgaaaagggcgctgagatgatgcgcgaggagttcgagccggacacgatcatc
gcggttggcggcggctccccgatggatgcctccaagattatgtggctgctctacgagcac
ccggaaatcgccttctccgacgtgcgcgagaagttcttcgatatccgtaagcgcgccttc
aagatcccgccgctgggcaagaaggccaagctggtgtgcatcccgacctcctccggcacc
ggttccgaggtcaccccgttcgccgtgatcaccgatcacaagaccggctacaagtacccg
atcaccgactacgcgctgaccccgtccgtggccatcgtggacccggtgctggctcgcacc
cagccgcgcaagctggcctccgacgccggcttcgacgccctgacccactcgatggaagcc
tacgtgtccgtgtacgcgaacgacttcaccgacggcatggccctgcacgcggccaagctc
atctgggacaacctggctgagtccgtcaatggcgagcccggcctggccaagaccaacgct
caggagaagatgcacaacgccgccaccatggccggcatggcattcggctccgcgttcctc
ggcatgtgccacggcatggcccacaccatcggtgccctgtgccacatcgcccacggccgt
accaactccatcctgctgccgtacgtgattcgctacaacggccagattcctgaggagccc
acctcttggccgaagtacaacaagtacatcgccccggagcgctaccaggacatcgcccgc
aacctcggcatcgacaccggcaagaccccggccgaagccgtggagaacctggcgaaggcc
gtcgaggactaccgtgacaacaagctcggcatgaacaagagcttccaggattgcggtgtg
gacgaggactacttctggtccgtgctcgatcagatcggcatgcgcgcctacgaggaccag
tgtaccccggccaacccgcgcatcccgctgatcaacgacatgaaggacatcgccgtcggt
gcttactacggtgtctcccaggcggaaggccacaagctgcgcatcgagcgcgagggtgag
gccgccactgaggaagcctccgagcgttga

DBGET integrated database retrieval system