KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1802Help
Entry
BLLJ_1802         CDS       T01419                                 

Definition
dTDP-4-dehydrorhamnose reductase/dTDP-4-keto-6-deoxyglucose-3,5-epimerase
Orthology
K00067  
dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    BLLJ_1802
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BLLJ_1802
Enzymes [BR:blm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     BLLJ_1802
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     BLLJ_1802
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2162188..2163642)
Genome map
AA seq 484 aa AA seqDB search
MSFEFEKDLKVEETNIPGLLVFDLPVHGDNRGWFKENWQRAKMTALGLPDFGPVQNNISF
NATKGVTRGIHAEPWDKYISIAAGEIFGAWVDLRPGESFGQVYTTRLDPSKAIYVPRGVG
NSFQALQDGTVYTYLVNAHWSLEQKKTYTFVNLADPELGIEWPIPLEESERSEADLHHPM
LRDAKPMEPKRTLVTGCNGQLGRAVRAYAEAHGLRGFEYTDIDEFDFSDPTAYDKYDWSL
YGTIINAGAYTAVDRAETAEGRPVAWKANAQGPALLARVAKDHHITLVHVSSDYVFDGTA
DLHSEDEAFAPLGVYGQTKAAGDIAVANAPEHYILRSSWVIGEGRNFVKTMMMLSDRVAN
PDDQLEQVTVVDDQYGRLTFTKDMAEAIFHLLDSHAPYGTYNLTGSGAVRNWAQIASRVF
ELTNGNGEKVKPISTAEYFANAKAPVSPRPEHSALDLSKIKAAGYTPADWEETLEAYVNK
ELGK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgaattcgagaaggacttgaaggtcgaggagacgaacatcccgggcctgttg
gtgttcgacctgccggtacatggtgacaatcgtggctggttcaaggagaactggcagcgg
gcgaagatgaccgcgttgggcctgccggatttcggtccggtgcagaacaacatcagcttc
aacgcgacgaagggcgtgacgcgcggcatccatgcggagccgtgggacaagtacatctcg
atcgcggcgggtgagatcttcggcgcgtgggtggacctgcgcccgggcgagagcttcggc
caggtgtacacgacccgtttggacccgtccaaggcgatctacgtgcctcgcggcgtgggc
aacagcttccaggccttgcaggacgggaccgtgtacacgtatctggtgaacgcgcattgg
tcgctggaacagaagaagacgtacacgttcgtgaacctcgcggacccggagctgggcatc
gagtggccgatcccgttggaggagtccgaacgctccgaggcggacctgcatcatccgatg
ctcagggatgcgaagccgatggagccgaagcgcacgctggtgacgggctgcaacggccag
ttgggccgtgcggtccgcgcgtacgcggaggcgcatggtctgcgtggtttcgagtacacg
gacatcgacgagttcgacttctccgatccgaccgcgtacgacaagtacgattggagcctg
tacggcacgatcatcaacgcgggcgcgtacacggccgtggacagggcggagaccgcggag
ggccgtccggtggcgtggaaggcgaacgcgcagggcccggccctgctcgcgagggtcgcg
aaggaccatcacatcacgctggtgcatgtgagctccgactacgtgttcgacggcaccgcg
gacctgcattcggaggatgaggcgttcgcgccgttgggcgtgtacgggcagacgaaggct
gcgggcgacatcgcggtggcgaacgcgccggagcactacatcctgcgttccagctgggtg
atcggcgagggccgcaacttcgtgaagacgatgatgatgctgtcggaccgtgtcgcgaac
ccggacgaccagctggagcaggtgacggtggtggacgaccagtacgggcgcctcacgttc
acgaaggacatggccgaggcgatcttccacctgctggactcgcatgccccgtacggtacg
tacaacttgaccggttccggcgcggtgaggaactgggcgcagatcgcgtcccgcgtgttc
gaactgacgaacggcaacggggagaaggtcaagccgatcagcacggccgagtacttcgcg
aacgcgaaggcgccggtcagcccgcgtcccgagcattccgcgctcgacctgtccaagatc
aaggccgccggctacacgcccgccgactgggaggaaaccctcgaagcatacgtgaacaag
gaactcggcaagtag

DBGET integrated database retrieval system