KEGG   Bifidobacterium longum subsp. longum JCM 1217: BLLJ_1917Help
Entry
BLLJ_1917         CDS       T01419                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
blm  Bifidobacterium longum subsp. longum JCM 1217
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:blm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BLLJ_1917
Enzymes [BR:blm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BLLJ_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366857..2367807
Genome map
AA seq 316 aa AA seqDB search
MSPVISHPRSAAARHQSDELSPITITVDCPAKTNLTLEVGPAHDEWGGRHELDTIYCAIG
VYDTVTATAKQPGAGFSLELEGAYLGDLASSRSDMRRNHAVLALFAMAQAAEREPDVALT
ITKRIPVGAGLGGGSADAAATMLAVNRLWELNWPIERLRTIAATLGADMPFCLTGGLAYG
TGFGERITDIAPGSRDELALIEQGFSGEVLVGAYQSQLSTPEVYHTFDIVGAAEGDRNHL
QAAAISLHPRSGQAIDAATQAGASHAFVSGSGPSVVAFAADEAAAQRIIEVWRDTAVVDR
IIRAKSPEHPNISVRQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggtaatctcacatccacgctcagccgctgcccgacatcagtccgatgagctc
tcccccatcaccattacggtggattgcccggcgaaaaccaatctcaccttggaagtggga
cctgctcacgacgaatggggcggacgccacgaactggacaccatctactgcgcaatcggc
gtatacgacaccgtcaccgcaaccgccaagcaacccggagcaggattctctctggagctc
gaaggcgcttatttgggcgacttggcctcctcacgcagcgacatgcgccgcaaccatgcg
gtactggccctcttcgccatggcccaggcggccgagcgcgagccggatgtggcgttgacc
atcaccaagcgcattcccgtgggtgccggactaggcggcggttcagccgacgccgcggcg
accatgctggcggtcaatcgtctctgggagctgaactggcccatagagcgcctgcgcacc
attgctgccacgttgggcgcggacatgccgttctgcctgaccggtggccttgcatacggc
accggtttcggcgaacgcatcacggatatcgcccccggcagccgcgatgagctggcgctg
atagaacagggattcagcggcgaagtattggtcggcgcataccagtcgcaactcagcact
cctgaggtctaccacacctttgacatcgtgggagccgcagaaggcgaccgcaatcatctg
caggctgcggcaatcagcctgcatccccgcagcgggcaggccatcgacgccgccacgcag
gcgggtgccagccatgcattcgtctccggatccggcccctcagtggtcgctttcgccgcc
gacgaggcagcggcacaacgcattatcgaggtgtggcgcgatacagctgtggtcgatcgt
attattcgagccaaatctcccgaacaccccaatatcagcgtcagacagtga

DBGET integrated database retrieval system