KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0085Help
Entry
Blon_0085         CDS       T00794                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bln00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
101862..102953
Genome map
AA seq 363 aa AA seqDB search
MQVTMIDENKYAEMMADVVLPALEQCREEGWFDPSAAERSAGVEPLSGIMDTGGRSGQLH
YLCYDSAKFDAIREQGATAVFRGAIVISHGFTEFAEKYDELVWYFLLAGYSVCVLEHRGH
GKSARDVDDHCMVWIDDWRRYVADLAGFAETIGQQYAAGMPLNLFCHSMGGGIGAALLER
YPALFDKAVLSAPMIAPATGMPLGVARVLVNALCGLGFGKKRVFGQSDFTPEFSMKGNEG
ASEARERWYFRLRCENREYQTYCATFEWVRQALKLNRAVLRPSACAEVETPVMLFQAGRD
VWVLNKPQNRFIQLVKDGGGEADLVRFPESRHEIFSMPNSTYKPYLEKILGFYDDPTIAS
ATY
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgacgatgatcgacgaaaacaagtacgccgaaatgatggccgacgtggtgctg
cccgcgctcgaacaatgccgcgaggagggctggttcgatccgtccgccgccgaacgttcg
gccggggtcgagccgctgtccggcattatggacaccggcggccgctcgggccagctgcac
tacctgtgctacgattccgccaaattcgacgcgattcgcgaacaaggcgccaccgccgtc
ttccgcggggccatcgtcatcagccacggcttcaccgagttcgccgagaagtacgacgaa
ctggtctggtacttcctgctcgccggctattcggtgtgcgtgctcgaacatcgcggccac
ggcaagtccgcgcgcgacgtggacgatcattgcatggtgtggatcgatgattggcggcgc
tacgtggccgatctggccggcttcgccgaaaccatcggccagcagtacgcggccggcatg
ccgctgaacctgttctgccattcgatgggcggcggcatcggcgcggccctgctcgaacgc
taccccgccctgttcgacaaggcggtgctctccgcccccatgatcgcccccgccaccggc
atgccgttgggtgtggcccgtgtgctggtcaatgcgctgtgcggactcggcttcggcaag
aagcgcgtgttcgggcagtcggacttcacgccggaattctccatgaaaggcaacgagggc
gcgtccgaggcgcgtgaacgctggtatttcagactgcgttgcgaaaaccgtgaataccag
acctactgcgcgacgttcgaatgggtgcgtcaggcgctcaagctcaaccgggccgtgctg
cgcccgtccgcctgcgccgaagtggagacgccggtgatgctcttccaggccggccgagac
gtgtgggtgctcaacaaaccgcagaaccgtttcatccaactggtcaaggacggcggcggc
gaggccgatctcgtgcggttccccgaatcacgccacgagatcttctccatgcccaacagc
acctacaagccctacctcgaaaagatccttggcttctacgacgatccgacgatcgccagc
gccacgtactga

DBGET integrated database retrieval system