KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0128Help
Entry
Blon_0128         CDS       T00794                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Blon_0128
Enzymes [BR:bln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Blon_0128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150129..151655
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHGIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEDLAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDSLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNPPIVDID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcattgcttacgccgatcgtctcggcgatggcactcttagc
tcgatgaccgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccacaccaaa
gtcgacccgcgtctcggcagctgggacgacgtcgctgaactttccaagacccacggcatc
atggtcgatgccatcgtcaaccacatgagctgggaatccaagcagttccaagacgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtcttcccg
aacggcgccaccgaagaggatctggccggcatttaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgcctggtctgggtcagcttcaccccgcagcag
gtggacatcgacaccgattccgacaagggctgggaatacctcatgtccatcttcgatcag
atggccgcatcccacgtcagctacatccgtctcgacgccgtgggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcacgcctacgcgag
gaaggcgtcaagcgaggcctcgaaattctcattgaggtgcatagctactacaagaagcag
gttgaaatcgcctccaaggtggaccgcgtctacgacttcgccctgcctccgctgctcctg
cactcgctgttcaccggtcacgtggaacccgtggtccactggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgatagtctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgccgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcagtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgcaagaccaacaacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcggactcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacccgccgattgtcgatatcgactaa

DBGET integrated database retrieval system