KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0139Help
Entry
Blon_0139         CDS       T00794                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bln00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(163969..166206)
Genome map
AA seq 745 aa AA seqDB search
MTDAHGNDAATITGTIADATNDAASGASQRTESAERLTRPLVKLAKTCGLATSFIDQLGT
YTEISDAALVAVLNALDVDASSDEAIARSMTQLEVENSKRLLPSTIVATTGKPTGITLNC
SSDADIIVSIELEDGTAFGHFALLPHLNSGKPDLTIAPDLPMGYHTLTVTVDGREGKAAI
IAAPARIPVPEAVAEHQRWGWMTQMYSVRSRESWGIGDYGDLKLLLADAADKSKADFMLI
NPIHAGAPIPPLEPSPYLPESRRFLNVTYIRPQDIPEYGTLPADIRAQVDALHDSVAARN
DESNPMDINAAWAAKRPALRLIFDAGRNNKRELEFEHFKTTAGPDLDSFATWCLCFEVWG
APWGENRWFFEKTIDDPAVRQLVEEHHDLFEFNRWLQWIAAEQVNAAQQEALDHGMTLGL
MQDMAVGVHGLGADAWANPERFASGGVTVGCPPDFYNQQGQDWGQPPFSPRYLEATGYQV
YREMVHSMYEHAGAVRIDHVLGLFRLWWIPQGLGALNGAYVTYNHEAMLGVLAIEATRAG
GMVVGEDLGTVPDYVRRILADHGVLGTDVEWFNRVDDSPNAGDPYRTPEDYRKQALASVT
THDLPPTAGYLNFEHVKLREELHLLSEPVEAFAASAMAERTAMMNRLVENGYISQTVADD
VEGHVQEIVEAMHAMLTDTPSLLLQAALVDGVGECRSQNQPGTSSEYSNWRVPLADSSGH
VVHTDEVFDLPRVQSLAAVMRREKR
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgcacggcaacgacgcagcgaccatcaccggcaccatcgcagacgccacc
aacgacgccgcttccggtgcctcgcagcgtacggaaagcgctgaacgactcacccgtccg
ctggtcaagctggccaaaacctgcgggcttgccacctcattcatcgaccagctcggcacc
tacaccgaaatcagcgacgcggccttggtcgccgtactcaatgccctcgacgtggacgca
tccagcgacgaggccatcgcacgctccatgacccaacttgaggtggaaaacagcaaacgt
ttgctcccctccaccatcgtcgccaccaccggcaaaccgaccggcatcaccctgaactgt
tcgtcggacgcggacatcatcgtctccatcgagctggaggacggcaccgcgttcggccac
tttgccctgctgccgcacctcaattccggcaagccggacttgaccatcgctcccgatctg
ccgatgggctaccacacactgaccgtcacggtggacgggcgagagggcaaggcggccatc
atcgccgcccccgcgcgcattcccgtgccggaggcggtcgccgagcaccagcggtggggc
tggatgacgcagatgtattccgtgcggtctcgcgaatcgtggggcatcggcgattacggc
gatctgaagctgctgctggcggacgcggctgacaagtccaaagccgacttcatgctcatc
aacccgattcacgccggcgcgccgattccgccgcttgagccatcgccgtatttaccggaa
tcgcgccgattcctcaacgtgacgtacatccgcccgcaggacatccccgaatacggcacg
ctgccggccgatatccgagcgcaggtggatgcgctgcatgattcagtggccgcacgcaac
gacgaatcgaacccgatggacatcaacgcggcgtgggcggccaaacgcccggcgctgcgc
ctgatcttcgacgcgggccgcaacaacaagcgcgagctcgaattcgagcatttcaagacc
accgccggcccagacctcgattccttcgccacctggtgcctgtgcttcgaggtatggggc
gcgccgtggggcgagaaccgttggttcttcgagaagaccatcgacgacccggccgtgcgc
cagctcgtcgaggagcaccacgacctgttcgagttcaaccgttggctgcagtggattgct
gccgagcaggtgaacgccgcgcagcaggaggcgctggaccacggcatgacactgggtctg
atgcaagacatggccgtgggcgtgcacgggctcggcgcggatgcctgggccaatccggaa
cgcttcgcctccggcggcgtcacggtcggctgcccgccggacttctataaccagcagggc
caggattggggccagccgccgttcagcccacgctatctggaggccaccggctaccaggtg
taccgcgagatggtgcattcgatgtacgagcacgcgggcgcggtgcgcatcgaccatgtg
ctgggcctgttccgcctgtggtggattccgcaggggctcggcgccctcaacggcgcatac
gtaacgtacaaccacgaagcgatgctgggagtactggccatcgaagccacgcgcgccgga
ggcatggtggttggcgaggatctgggcaccgtgccggattacgtgcgccgcattctggca
gatcacggcgtactcggcactgacgtggaatggttcaaccgcgtggacgattcgccgaac
gccggcgacccgtaccgcacacccgaggactaccgcaagcaggcattggcctcggtgacc
acgcacgatctgccacccaccgccggctacctgaacttcgaacacgtcaagctgcgcgag
gagctgcatctcctgagcgagccggtggaggcgttcgccgcctcggcgatggccgaacgc
acggccatgatgaaccgtctggtggagaacggctatatatcgcagaccgtggcggatgat
gtggaaggccatgtgcaggagatcgtggaggcgatgcacgccatgctcaccgatacgccg
tcgctgctgctgcaggcagcgttggtggacggcgtgggcgaatgccgttcccagaatcag
ccgggcacttccagcgagtattcgaactggcgcgtgccgctggcggacagctcaggccac
gtggtgcataccgacgaggtcttcgacctgccacgcgtgcagtccctagccgccgtgatg
cgccgagagaagcggtga

DBGET integrated database retrieval system