KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0161Help
Entry
Blon_0161         CDS       T00794                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bln00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Blon_0161 (recR)
DNA repair and recombination proteins [BR:bln03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Blon_0161 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
190317..190919
Genome map
AA seq 200 aa AA seqDB search
MALAYDGAIQRLIDAFGRLPGIGPKGAQRIAFYMLSAPEDEARDLAEAIEEVKAKIRFCD
ICGNVCESSPCPVCADPRRDRSVICVVEEPKDVMSIERTREYRGLYHVLGGAINPMANVG
PADLRIPSLLKRLEGDEVKEVIMALDPNIEGEATTSYLTQLLRPVGVKVTRLASGLPVGS
DLEYADEITLGRALAGRREA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgcttatgacggcgcaatacagcgactgatcgacgctttcgggcggctgccc
ggcatcgggccgaagggcgcgcagcgtatcgccttctacatgctgtccgcgcccgaagat
gaagcgcgcgatctggccgaggccatcgaggaggtcaaggccaagatccgcttctgtgat
atttgcggcaacgtgtgcgaatccagcccctgcccggtatgcgccgacccgagacgcgac
cgttcggtgatctgcgtggtcgaagagcccaaggacgtgatgagcatcgagcgcacgcgc
gaataccgcggcctataccatgtgctcggcggcgcaatcaacccaatggccaacgttggc
cctgccgacctgcgtattcccagtctgctcaaacgcttagaaggcgatgaggtcaaggaa
gtgattatggcgctcgacccgaatattgaaggcgaggccaccaccagctacttgacccag
ctattgcgacccgtaggtgtcaaggtcacccgacttgccagcggcctgccggtgggctcc
gacttggagtacgccgacgaaatcacgctaggcagggcactggccggtcggcgcgaggcc
tag

DBGET integrated database retrieval system