KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0640Help
Entry
Blon_0640         CDS       T00794                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Blon_0640
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Blon_0640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
736855..737835
Genome map
AA seq 326 aa AA seqDB search
MTASDILAALDRIQGTVCVVGSMNADYTVVTERLPGPGETVTGGPLQVLPGGKSGNQAAA
AARIGATVHMFGAVGSDANAEFLLGALREAGVDTQHVRHVPGASGTTVITVDANGENTIV
YSPGSNAQVSVDYIEAMRGELTSANVLGLCLESPIETVTAAARIGHEAGVPVLLNNSPFT
PVLPDELVQLADILLVNEHEMAQMFGIAEPEDGDWSGFDWLAAADRMRELGFDRAIVTLG
GDGSMVLDASCAVASVTRIAPVRVEAVDTTGCGDSFMGAVLAGLASGFELREAAQLASFV
SAYAATGLGAQASYGSAAQIRELFVP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatctgacattcttgcggcacttgatcgaatccaaggcacggtttgcgtcgtc
ggttcgatgaatgccgattacacagtggtcaccgagcgtctgcccggaccgggggagact
gtcaccggcggcccgctgcaagtgttacccggcggcaaatccggcaaccaggctgctgct
gcggcacgtattggcgccactgttcacatgtttggagcggtgggttccgatgccaatgcc
gagttcctgcttggtgcattgcgagaagccggcgtggatacccagcacgtgcgtcatgta
ccgggggccagcggtaccacagtcatcaccgtggacgcgaacggagagaacacgattgtc
tactctccgggctccaatgcgcaggtcagtgttgattatatcgaggcgatgcgcggtgaa
ttgacttcggcgaatgtgcttggcctgtgcttggaaagcccgatcgagaccgttaccgcg
gctgcgcgtatcgggcatgaagccggtgtgccggtactgctcaacaattcaccgtttacg
ccggtgctgccggacgagctggtgcagcttgccgatatcctgctcgtcaacgagcatgag
atggcgcagatgttcggtatcgccgaacccgaagacggcgactggtccggattcgactgg
ctggctgcggccgatcgtatgcgggagctcgggttcgaccgggcgattgtgacgctcggc
ggtgatggctcgatggtgctggatgcatcatgtgctgttgcttcggtgacccgcatcgca
ccggttcgggtcgaagccgtggacaccaccggttgcggcgactcgttcatgggtgccgtg
ctggcagggctggcctcaggctttgagctgcgtgaagcggctcagctggcttcgttcgtt
tctgcatatgcggctaccggtctgggtgcccaagcgtcttacggttccgccgcccagatt
cgtgagctatttgtgccctga

DBGET integrated database retrieval system