KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0725Help
Entry
Blon_0725         CDS       T00794                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00010  Glycolysis / Gluconeogenesis
bln00520  Amino sugar and nucleotide sugar metabolism
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01200  Carbon metabolism
Module
bln_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_0725
   00520 Amino sugar and nucleotide sugar metabolism
    Blon_0725
Enzymes [BR:bln01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Blon_0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACJ51829
JGI: Blon0725
UniProt: B7GPU9
Position
836250..837017
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGALIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSEKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaccgcacaggcttttggcgtcgacatcggaggatccggcatcaaggccgcg
cccgtcgacctcaccaagggcgacttcgccgaaccgcgactgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgccttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaacctcgaccagtcttggattggcgtggacgttactgaggtgttctcc
gaagcctgcggacgcccggtcgtcgtggtgaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatctacaacggcgcgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtacgcctcctccgcgattcgcgag
aacgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gagaagtacttcaacccggacctgttcaccgtcggcggcggcgtgagccgtcagagcgaa
aagttcctgccgtacgtggatatcaagaccccgattgtgcccgccaagctgcgtaaccag
gctggcatcgtcggtgccgcctactacgccagcaccaagcagcagtga

DBGET integrated database retrieval system