KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_0779Help
Entry
Blon_0779         CDS       T00794                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00900  Terpenoid backbone biosynthesis
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Blon_0779
Enzymes [BR:bln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Blon_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ACJ51882
JGI: Blon0779
UniProt: B7GQ02
Position
902779..903969
Genome map
AA seq 396 aa AA seqDB search
MSIASNSTVIILGSTGSIGTQGLDVIARHPERFTVTGLAAGGAHIELLAQQAAQFHVSEV
AVFDETKIPALQAALAQAGAQGVRVTGGPDSVIAMAGSGANVVLNGITGSIGLEPSIAAL
KAGSQLALANKESVVAGGHLLFSAQVRENQINPVDSEHSAIWQSLRSGTHAEVAKLVVTA
SGGPFRGWKRADMENITPEQALHHPTWNMGPVVTINSSTLMNKGLEVIEASRLFDVPPER
IDVTVHPQSIVHSMVEFVDGATICQASPPDMRLPIALGLSAPDRMANVAAACDWTKAATW
TFEPLDDEAFPAVQLARHCLAASEKHTAVLNAANEQAVHAFLEHRLPYLGIVDTVKAVLD
QMDAELRGNPLFTDVEEMNQLELEARRRADDLINKQ
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatagcctccaactccaccgtcatcattctcggatccactggatccatcggcacc
caaggacttgacgtcatcgcgcgtcaccctgaacgatttaccgtcaccggtctggcggcg
ggcggagcacatatcgagctgctggcgcaacaggccgcacagttccatgtgtccgaagtc
gcggtgtttgatgagaccaagattccagcactgcaagcagctctcgcacaggccggcgca
caaggtgtccgcgtgaccggcggtccggattcggtcatcgccatggccggatccggtgcg
aatgtcgtattgaacggcatcaccggctccatcggcctcgaaccgtcgatcgcggcgctc
aaggccggttcccagctggcattggccaacaaggagtccgtagtcgcgggcggtcatctg
ctgttcagcgcccaagtacgcgagaaccagatcaacccggtcgattccgaacattccgcc
atctggcaatccctgcgctccggaacccacgccgaagtcgccaagcttgtggtcaccgcc
tccggcggaccgttccgcggttggaaacgtgccgacatggagaacatcactcccgagcag
gcgctgcatcatccgacgtggaacatggggccggttgtcaccatcaactcctccacgctg
atgaacaaggggctcgaagtcatcgaggcgtcccgcttgttcgacgttccgcctgaacgc
atcgacgtgaccgtgcacccgcagtccatcgtccattccatggtcgaatttgtggacggc
gccacgatttgccaggcttcgccgccggacatgcgtctgcccatcgcgctgggcctgtcc
gcgccggaccgcatggccaatgtggccgccgcgtgcgactggacgaaagccgcaacttgg
acctttgaaccgttggacgatgaggcgttccccgccgtgcaactggcccgtcactgcctg
gccgcctccgagaagcatacggcggtgctgaatgcggccaatgaacaggccgtgcatgcc
ttcctcgagcatcgtctgccatacctcggcatcgtggacacggtcaaagccgtgctggac
cagatggacgccgagcttcgtggtaacccgctgttcacggacgtggaggaaatgaaccaa
cttgagcttgaagcccgccgacgcgccgacgacctgataaacaagcaatga

DBGET integrated database retrieval system