KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1086Help
Entry
Blon_1086         CDS       T00794                                 

Definition
(GenBank) protein of unknown function DUF199
  KO
K09762  uncharacterized protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LAGLIDADG_WhiA HTH_WhiA WhiA_N DUF592
Motif
Other DBs
NCBI-ProteinID: ACJ52176
JGI: Blon1086
UniProt: B7GQU6
Position
1272398..1273348
Genome map
AA seq 316 aa AA seqDB search
MALLDDVKSELAAFEGDSPAAIKAQAAAMIRFGGGLRPVQNTYVIQAVFTSLDVAEWLKN
TLRNTFGHEAEINHLTRQTPNGPVETYVVLVTRNVVALALQTGLVDRRKQQVRGLPSEVV
NGSIAQIKAAWRGAFMARGFLSDPGKASFLEIACPTEEAAMALCGVARRLGIQAKHRTLR
SSERVTLKDPDAIERMLKLMGATRSAREWTGKRSDGEARGKANRLANFDDANMRRSAKAA
AEASEKVQHAFEVLGDNIPDNLRQAGQLRIDHVDKSLEELGKIAEPQITKDAIAGRIRRL
LQLAEKTEKARAAEGK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttggctcttctggacgatgtcaaaagcgagttggcggcctttgaaggcgattcgccagcc
gcgatcaaggcccaagctgcggccatgatccgttttggcggcggtcttcgaccggtacag
aatacatacgttatccaagccgtattcacctcgcttgacgttgcagaatggctgaagaac
acgttgaggaacacgttcgggcacgaagccgagatcaaccacctcacccgtcagaccccg
aacggccctgtcgagacctacgtggtgctcgtcacccgcaacgtagtggccttggctttg
cagaccggactggtcgaccgccgcaagcagcaggtccgtggactgccgtctgaagtggtc
aacggatccatcgcccaaatcaaagcggcatggcgcggcgccttcatggcccgtggcttc
ctatccgatcccggtaaagccagcttcctggaaatcgcttgccctacggaagaggccgcc
atggccctgtgtggcgtggcccgtcgtctcggcatccaggccaagcatcgcacgctgcgc
agctccgagcgcgtgaccctcaaggatcccgacgccatcgaacgcatgctcaagctcatg
ggcgccacccgttcggcccgcgaatggaccggcaagcgctccgatggagaggcccgcggc
aaggccaatcgtctggccaacttcgatgacgccaatatgcgccgttccgccaaggccgcc
gccgaagccagcgaaaaagtgcaacatgctttcgaagtgctcggcgataacattccggac
aacctccgtcaggccggccagctgcgcatcgatcacgtggacaagagcctcgaggagctc
ggcaagatcgccgaaccgcagatcaccaaggatgcgattgccggacgaattcgccgactg
cttcagcttgccgagaagacggagaaggctcgagcagccgaaggcaagtaa

DBGET integrated database retrieval system