KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1088Help
Entry
Blon_1088         CDS       T00794                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Blon_1088 (tpiA)
   01230 Biosynthesis of amino acids
    Blon_1088 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_1088 (tpiA)
   00051 Fructose and mannose metabolism
    Blon_1088 (tpiA)
   00562 Inositol phosphate metabolism
    Blon_1088 (tpiA)
Enzymes [BR:bln01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Blon_1088 (tpiA)
Exosome [BR:bln04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Blon_1088 (tpiA)
  Exosomal proteins of bladder cancer cells
   Blon_1088 (tpiA)
  Exosomal proteins of melanoma cells
   Blon_1088 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1274780..1275583
Genome map
AA seq 267 aa AA seqDB search
MASKRIPLVAGNWKMNFDHLEATYFVQKLVWLLRDAHFDFKRCEVALFPSFTSLRSVQVL
VEADKLHVAYGAQSVSVTTQGAFTGDVSADMIAHLGCSYVIVGHSERRKYHPEDDANIVD
QVRAVFAAGMQPILCVGESFEERRQGIELDFAVGQVRDVTRDLNEEQAAELIVAYEPVWA
IGTGMVATPQSAQDAANAIRNDLKTTFGTKVSDSVHILYGGSVTSKNAAELISQPDVDGF
LIGGAALDVEELAKIARLALKSMKSRN
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaaacgcattccgttggtggccggcaactggaagatgaatttcgaccatctt
gaagccacttacttcgtgcagaagctggtatggctgttgcgtgacgctcacttcgacttc
aaacgctgcgaagtcgcgcttttcccctcgttcacgtcattgcgcagcgtacaggtgctg
gtcgaagccgacaagctccatgtcgcctacggcgcacaatccgtttccgtgaccacccaa
ggtgccttcaccggcgatgtgtccgcggacatgatcgcccatctcggctgctcatacgtc
atcgtcggccactccgaacgccgcaaataccatcctgaagatgacgccaatatcgtcgat
caggtacgtgccgtgttcgccgccggcatgcagccgattttgtgcgtcggcgaaagcttc
gaggaacgacgtcaaggcattgaactcgatttcgccgtgggccaggtacgagacgtcacc
cgcgatctcaacgaagaacaagccgccgaactcatcgtggcctacgaacctgtctgggcc
attggcaccggcatggtggccactccgcaatccgcccaggatgccgcaaacgccatccgc
aacgatttgaagaccacctttggcacgaaggtatccgatagcgtacatatcctgtacggc
ggatcggtcacctcgaaaaatgcggcggaactcatttcccagcccgacgttgacggcttc
ctgatcggaggggcggccttggacgttgaggaactcgccaaaatcgctcgattggcactt
aaatccatgaaatcacggaactaa

DBGET integrated database retrieval system