KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1099Help
Entry
Blon_1099         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1288652..1288912)
Genome map
AA seq 86 aa AA seqDB search
MTDNPTDTPASTDIVPDWLIPSRVYDILKWLGLIVLPALALFVGTVGPAWGWPHVDAIVT
TLNALGILAGALIGVSAIKQRLDRAA
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaatccaaccgatacaccggcatccaccgacatcgtgcccgactggctcatc
cccagccgcgtctacgacatcctcaaatggctgggcctcatcgtcctgcccgcactcgcc
ctgttcgtgggcacggtcggccccgcatggggctggccccacgtggacgcgatagtgacc
acgctcaacgcgctcggcatcctcgccggcgcgctcatcggcgtcagcgccatcaaacag
cgcctcgaccgcgccgcataa

DBGET integrated database retrieval system