KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1103Help
Entry
Blon_1103         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Reo_sigmaC DUF1664 Filament
Motif
Other DBs
NCBI-ProteinID: ACJ52193
JGI: Blon1103
UniProt: B7GQW3
Position
complement(1290931..1295406)
Genome map
AA seq 1491 aa AA seqDB search
MFFFGGYLMALHGEINPSDLDLLLGTGLNALEVATGLLTRRSGGVWIDTGDGSGILAGGN
ASDGVNRVDKNGVQLPLVDTSGIDKAAKDAQQKAIAAAAKADEAIAKGEQIRRDAQAGID
DVRKQAQDSAAKADGVRSDLESQTTALKSSISAVDAKANQVKAAADKISQRVDADKAALD
KSIADVDAKAQAASDKGDKLAGQIGDVTTTVNGHTTKLDALSTRIEGVASDGQATTKSLT
SLRQTVTGLSSTVSQSTKTASDAMSKATQVEQTANGISANLSKNYTSTAESNKKYAAKTE
LKTTAEGLQANITKSLQTADGAVTAASKAQATADGINATLSKDYQTAKDSDAKYSTKAEL
KATSNELSSSLSSVRQMADGAVTAASKAQQTADGISANLSKNYATKSDNDATYATQTSLK
ATSDSLAASINSNAKTAQGAVDKATNLEANLNGFKTTVADTYQSKGIGDEIVENGIPNPD
RPNKFCLEIVDGVFQRTFPGKENHVDYGPSEILHQIGPHRTIRYAIDVRLVSGKDTVAEG
DSINAIGTDVGWFAINVKLKDLVDGEWHSYEAYQDLGNAVVTRVYMSSYVGSEGAKVLQF
RHVSVKDVTSEHKTYSTKSELTQTANSIKAEVTEVSQTATGAMSKVTTLEQTANGLSAKV
GETARTLDATVQTVNQVKSTADSNKATISQVSTTANDALSRTPSLEQNLSGFKTEVSSTY
ATKSDLDNRPSGSNLWCNQLFDPDKPQITSLVDNVTAPNGSRVNLLAARDNFNPDTSFPV
IPGRTYVITAYCKQIKGGLPLHAGIWYTHLTSGPAYEGFVKAESTTPLGDGWMAATWRFA
CPAGKSRGCVYFQIDNWPWDSGSTQWYVANVTCTDVTGLQPAGDYATNSSLMQTANQIRG
EVSERYQSKNGMSSYATTSALTQKADEITGKVTEVAKTAQGNTTTISQVSQKVDRINTTL
SQQIGGKADTSRVSSLEQNLDGFKSTVAATYQTKGDYPSKAEVQSRIDQSASSIKSTVGQ
TYTTLDATEALRKSATRTFTLGGASGKAKWVKLGYLTSNGDSSSVLLHVYSGDGFNGAAR
QNAEFEIFVKDGWQEHPSASHAFGVSVNRIRNADDVKVKVLAFDDRSCDIWAYLPWAWWS
GHYALQGDYRSWNDGPNCSGERILDSEPTNGVAQNLAYDTLSTRSYVDQTSKSVALGVMQ
NYRGADGSGLATKSDITATANSITSTVSSTYATKSGVTQEISSKITQNNASLDVRFATKA
ENQTARDLANTAKSDASDARSRVGALEDCISLTSDGVQVGKRSNGVFTGPSALVGTDGAF
HVKTHAADGAVEDVVKLGHDLLAIKSKLKLSDGSHLDRLTAGPYGDNHFALRMNTAGAVF
NNHESVQIWQTGWQTITTGNGCEGYASYGYRGGCLRFRGRVKTTVNGDNSLFADPDLLDL
ATTPVNRNFLLPAYRNGKLEWTNTYVPANTKQVKIYGVWDWVSLDQLSIAQ
NT seq 4476 nt NT seq  +upstreamnt  +downstreamnt
atgttcttttttggaggttatctcatggcattacatggcgagatcaacccgtccgacctc
gatctgctgctcggcacgggcctcaacgcgttggaggtcgcgaccggtctgctcacccgc
agaagcggcggcgtgtggatcgacaccggcgacggcagtggcatcctcgccggcgggaac
gcctcggacggcgtcaaccgcgtggacaagaacggcgtccaactgccgttggtggacacg
agcggcatcgacaaggccgccaaggacgcgcagcagaaggcgatcgccgcggctgcgaag
gcggacgaggcgatcgccaagggcgagcagatccgccgggacgcgcaggcgggtatcgat
gatgtgcgcaagcaggcgcaggattccgccgccaaagctgatggtgtgcgctccgatctg
gagtcgcagacgacggcgctcaaatccagtatttccgccgttgacgcgaaggcgaatcaa
gtcaaggccgccgcggacaaaatctcgcagagggtggatgcggacaaggccgcattggac
aagagcatcgccgatgtggatgcgaaggctcaggcagcgagcgacaagggcgataagctg
gccgggcagatcggtgacgtgaccacgaccgtcaacgggcacacgacgaagctggatgca
ttgtccactcgtatcgagggcgtcgcttcggatggtcaggccacgactaagagtctgacc
tctttgcggcagaccgtgaccggcctcagctcgacggtatcgcagagcacgaagaccgcg
tcggatgcgatgagcaaggcgacgcaggtcgagcagaccgcgaacggtatcagcgcgaat
ttgagcaagaattacacgtccaccgccgagtccaataaaaagtatgccgccaagacggag
cttaagaccacggccgaaggcttgcaggcgaacatcacgaagtcgctgcagaccgcggat
ggtgccgtgactgcggcttccaaggcgcaggccactgcggacggcatcaacgcgactctg
agcaaggattatcagaccgccaaggattcggacgccaagtacagcacgaaggcggagctt
aaggccacgagcaatgaattatcctcgtccctatcctcggtgaggcagatggcggatggc
gctgtcacggccgcgtcgaaggcgcagcagaccgccgacggtatttccgcgaacctgagc
aagaactatgccacgaagtctgataacgatgccacgtatgcgacgcagacgagcctgaag
gccacgtcggattcgctggccgcgagcatcaattccaacgcgaaaaccgcccagggtgcc
gtcgataaggcgacgaatctcgaagcgaacctgaacgggtttaagaccactgtagctgat
acatatcagtccaaaggtattggtgacgagattgtcgaaaatggaattccgaatcctgat
cgaccaaataaattctgtctcgaaatagtcgatggagtatttcagcgtactttcccgggt
aaagagaaccatgtcgattatggcccatccgaaatccttcaccagatcggacctcatagg
actataaggtatgccattgatgtccgattggtatccggaaaagacacggttgccgaaggt
gatagtatcaacgccatcggaacagatgttggttggttcgcgatcaacgttaagttaaaa
gatcttgttgatggtgaatggcattcctatgaggcatatcaggatctcggtaatgctgta
gttactcgtgtatacatgtcttcatatgttggttctgaaggagctaaggttctccagttc
cgtcatgtgagtgtcaaggacgttacatctgagcataaaacatattccactaaatccgaa
ttgacccagacggcgaactccattaaagccgaagtaaccgaagtctctcagaccgccact
ggcgcgatgagcaaggtcacgacgctggagcagacggcgaatggcttgagcgcgaaggtc
ggcgagacggcgaggaccttggatgccaccgtgcagacggtgaatcaggtcaagagcacc
gccgacagcaataaggccacgatctcgcaggtcagtaccaccgccaatgatgcgctgtcc
cgcacaccgagcttggaacagaacctcagcggattcaaaaccgaagttagcagcacgtac
gcgacgaagtctgatctggataatcgaccctcggggtcgaatctctggtgcaatcagctt
ttcgaccctgacaagccgcagatcacgtcgctggtggataatgtcaccgcgccgaacggc
agccgggtcaacctgctcgcagcacgcgacaattttaatcctgacaccagtttccccgtc
ataccggggcgcacgtatgtcatcaccgcttactgcaagcagatcaaaggcggtttgccg
ctacatgctggtatctggtacacgcatctgaccagcggacccgcatatgaggggtttgtc
aaagcggaatcgacgacaccattgggcgatgggtggatggccgccacatggcgtttcgcc
tgtccggccgggaaatcccgcggctgcgtgtacttccagatcgacaactggccgtgggat
agcggttcgacgcagtggtatgtggcgaacgtcacctgcacggacgtgaccggattgcag
ccagcaggagattacgccacgaattcctcactgatgcagacggcgaaccagatccgcggc
gaagtgtcggagagataccagtccaagaacggcatgtcctcctatgccaccaccagcgcc
ctgacgcagaaggccgacgaaatcacaggcaaggtgacggaggtcgccaagaccgcccag
ggaaacacgaccaccatcagccaggtgtcccagaaggttgacaggatcaacacgaccctg
tcgcagcagatcggcggcaaggccgacacgagcagggtcagcagtctggaacagaacctc
gatggtttcaaatccactgtcgcggcgacctaccagaccaagggggactatccgagcaaa
gccgaggtgcagtccaggatcgaccagtcggcctcctcgatcaaatcgacggtcggccag
acctacacgaccctcgatgcgaccgaggcgttgaggaagagcgcgacccgcacattcacg
cttggtggcgcgtcgggcaaggcgaaatgggtcaagctcggctatctcaccagcaacggc
gactcgtcgagcgtccttctgcacgtctactccggcgacggcttcaacggcgctgcccgc
cagaacgcggagttcgagatcttcgtcaaggatggctggcaagaacatccgtccgcatcg
cacgcgttcggcgtgagcgtgaaccgcatccgcaacgcggatgacgtgaaggtcaaggtg
ctcgcgttcgacgatcggagttgcgacatctgggcgtacctgccgtgggcctggtggagc
gggcactacgcgctccagggcgactaccggtcatggaacgacggcccaaactgcagcggc
gagaggatactggactcggaacccacgaacggcgtcgcgcagaacctcgcgtacgacacg
ctcagcacgcgcagctacgtcgaccagaccagcaagtcggtggccttgggcgtgatgcag
aattaccgtggcgcggacgggtcgggactggccaccaaatcggacatcaccgccaccgcg
aacagcatcacaagcacggtgtcgtcgacgtacgcgacgaaatccggcgtcacgcaggag
atcagttcgaagatcacgcagaacaacgcgagtctggatgtcaggttcgcgacgaaggcc
gaaaaccagacggcgcgggatttggccaacacggccaaatcggacgcgtccgatgcacgg
tcgcgcgtgggggccttggaggactgcatcagcctcacatccgacggcgtacaggtgggc
aagcggtcgaacggcgtgttcacaggaccgtccgcactggtcggcaccgacggcgccttc
cacgtgaagacccacgccgcggacggcgccgtcgaggatgtggtcaagctcggccacgac
ctcctggccatcaaatcgaagctcaagctgagcgatggaagccacctcgaccggctgacg
gcgggaccatacggagacaaccatttcgcgctccgcatgaacacggcgggggccgtcttc
aacaaccacgaatcggtccagatatggcagaccggctggcagaccatcacgacaggcaat
ggatgcgagggttacgcgtcgtacgggtaccggggaggctgcctgcgcttccgaggcaga
gtcaagaccacggtcaatggcgacaacagcctcttcgccgaccccgacctgctcgacctg
gctacgacacccgtaaaccggaacttcctcctgcccgcctaccggaacggcaagctcgaa
tggacgaacacgtacgtaccggccaacacaaaacaggtgaagatctacggcgtctgggac
tgggtgtcactcgaccagctgagcatcgcccaatga

DBGET integrated database retrieval system