KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1107Help
Entry
Blon_1107         CDS       T00794                                 

Definition
(GenBank) phage tail tape measure protein, TP901 family
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhageMin_Tail DUF4156 Nup153
Motif
Other DBs
NCBI-ProteinID: ACJ52197
JGI: Blon1107
UniProt: B7GQW7
Position
complement(1298445..1301798)
Genome map
AA seq 1117 aa AA seqDB search
MAGGLNRNITVRLLADTSNFTAGMAKVSGESQKAATTMEAAGGKTKLITTGVAAAGVAAT
ALGVAAIKMAADFDASMSTVQANTGASADEMAQLRQAAIDAGADTVYSATESADAINELG
KAGLSTSDILSGGLSGALNLAASDGMAVGDAAELMATTLKQFNLTGAESTQVADALAAGA
GKAVGSAHDLGLALNQAGMVSHSFGISMQETAGTLAAFAESGMIGSDAGTSLKTMLISLA
NPSTKASNLMRELGINAYDAQGKFIGLSGLAGVLKDKLGGLSQEQRNQALATIFGTDAIR
AANVLYEQGAEGIDDWTDAVSESGFAAQQAAARNNNLKGDIENLSGSFKSLMISLGEGGQ
GPLRSLVQMLDTLVDGFSLLPAPVQQGIVLFTALAGGSVALHRAMAPLNASSSQLAQTIG
LIADPGQRLIGLGSGIASAFQAWGSTFGSAESQLSTFGAAVSRSQGVMAGFKNLGSGIVS
LLGGPWGIAIGVAGAALLSFADKAAEAKQRADSLKTALESTGDASKQIIDNLSNAKIDNS
WIIPDNIEQAYYGYKTLGSLLDDVGIKMSDMALAAQGNSAAMRRINGVTDEMIAKGGKQK
ELAGIILSQLNEEKDNYNKASDAAKSKANALAEVENATNGAADATGEYSNATQGATTSTQ
DLMDAIDDLVKGFLSVPGVQLSADQAVTKFNQGILDLNENIAKNGRVLDDNGNALAGYES
QAYGSQSALQGLASTAQSTAQKILEEGQAHGDAAAATQQAGDILERARQAYIANATAAGM
SADAAAAQADRYGLARSEADRLRQSIESMNSEAANPVDVRITITDEASDVLDKVKVKAEK
IDDKTVRLTGDDTDLMQKIADATNAKIDPKTGYLDLDKSQFDVAMAIAGGAKIDDKTGVL
KGNNTPLFDKMVEANGWQVDPKTGYIYGKNDQALQAIRDVNNEPLETPREVTITTNIVRN
FIETHMTKNVPDTSVGVRPAGKTGGLFTGYGVSMRGYAGGGRVIEGLLPGKATYTGDDNI
TLSNARVKSGEFVSNVKSVGYYGADLYAAMNRRQIPRERFYKPSPMMLSQPVTNNQTVNQ
TIAPVFQQKIVRPADDMYTAASIMYRNAAHLVGRLSR
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcgggttgaaccgcaacatcacagtccgcctgctcgcggacacgtctaatttc
acggccggcatggccaaagtcagtggcgagagccagaaggccgcgaccaccatggaagcc
gccggaggcaagaccaagctcatcaccaccggagtcgccgcagcaggggtggcagccacc
gcgttgggcgtagcggccatcaagatggcggcggacttcgacgccagcatgagcaccgtg
caagccaacaccggagccagcgccgatgagatggcccaactgcgtcaggccgccattgat
gccggtgccgacaccgtatactcggccaccgaatccgccgacgccatcaacgaactcggc
aaggccggtctcagcacgtcggatattctctccggcggtctgagcggcgcgttgaacctc
gcagcgtctgacggcatggccgtgggcgacgcagccgaactcatggccaccaccctcaag
cagttcaacctgacgggtgccgaatctactcaggtggccgacgcgctggcagccggtgcg
ggcaaggccgtcggttccgcgcacgacctcggtctggcgttgaatcaggccggcatggtg
tcccactcgttcggcatcagcatgcaggagaccgccggcacgctcgccgcgttcgccgaa
agcggcatgatcggctcggacgccggcacctcgctgaagaccatgctcatcagtctcgcc
aacccgagcacgaaggcctcgaacctcatgcgggaactcggcatcaacgcctacgacgca
caaggcaaattcatcggcctaagcggcttggcgggcgtgctcaaggacaagttgggcgga
ctgtcccaggagcagcgcaatcaggcgttggccacgattttcggcaccgacgccattcga
gccgcgaacgtgctctacgagcagggcgcggaaggtatcgacgactggaccgacgcggta
agcgaatccggtttcgccgcccaacaggccgccgccaggaacaacaacctcaaaggcgac
atcgagaacctcagtggttcgtttaaatccctcatgatttccctcggcgaaggcggccaa
gggccattgcgctccctcgtgcagatgcttgacacgctggtggacggtttcagcctgctg
cccgcaccggtgcagcagggcatcgtgcttttcacggctcttgccggcggctcggtcgca
ttgcacagggctatggcaccgttgaacgcgagcagcagccagcttgcgcaaaccatcgga
ttgatcgccgacccagggcaaaggcttataggcctcggctccggaatcgcgtcagcgttc
caggcatggggttcgactttcggcagtgcagaatctcagctaagcacgtttggcgccgcc
gtcagtcgttctcaaggcgttatggcaggtttcaaaaacctgggaagcggcatagtgtcg
ttattgggtggaccgtggggtatagccatcggcgtcgccggcgcggccctcctctccttc
gccgacaaggccgcagaggccaagcagcgagccgactcgctaaaaaccgcgctggaaagc
accggcgacgccagcaaacaaatcatcgataatctatcaaatgcaaaaatcgataactcc
tggatcattccggacaatatcgaacaggcgtattacggatacaagacccttggcagctta
ctcgatgatgtcggaatcaagatgtccgacatggcgttggccgcacagggcaactcggca
gcaatgcgccgaatcaacggtgtcaccgatgaaatgatcgcgaaaggcggcaagcaaaaa
gaactcgcgggaatcattctcagccagctcaacgaggaaaaggataactataacaaggca
tccgatgcagccaagtcaaaagccaacgcactcgctgaagtagagaatgctaccaacggc
gctgctgacgccactggagaatactcaaacgcaacacaaggcgctacgaccagcactcag
gatttgatggacgccatcgacgatctcgttaaaggcttcctcagcgtgcccggcgtgcag
ctgtccgcggatcaggccgtaaccaagttcaaccagggcatactcgacctcaacgagaac
atcgcgaagaacggtcgagtgctcgatgacaacggtaatgctttggcgggatacgagtct
caggcgtatggcagccagagcgcgctgcagggtctcgcctcgaccgcgcagagcacggcg
cagaagatcctcgaggaaggccaggcccacggcgacgctgcagcagccacccagcaggcg
ggcgacatcctcgagcgcgcacgccaggcatacatcgccaacgccacggcagccggcatg
agcgccgacgcggccgcagctcaggcagaccgttacggtttggcccgcagcgaggccgac
aggctgcgtcagagcatcgagtccatgaacagcgaggccgctaaccctgttgacgtgagg
attacgatcacggacgaggccagcgacgtgctggacaaggtgaaggtcaaggccgagaaa
atcgacgacaagaccgtgcgattgaccggtgacgacaccgacctgatgcagaagatcgcc
gacgccaccaacgcgaagatcgaccccaagaccggctacctggacttggataagagccag
ttcgacgtcgccatggcaatcgccggcggcgcaaaaatcgacgacaagaccggcgtcctc
aagggcaacaacacgcccctgttcgacaaaatggtcgaagcgaacggctggcaggtagat
cccaagaccggctacatctatggcaagaacgatcaggcattgcaggccattcgcgatgtg
aacaacgaacccttggaaaccccgagggaggtcacgataaccacgaacatcgtccgcaac
ttcatcgagacccacatgacaaagaacgtgccggatacaagcgttggcgttcgcccggca
ggcaagaccggtggcctgttcaccggctacggggtttcgatgcgcggctacgccggtggc
ggccgtgtcatcgaggggctgctgcccggcaaggccacctacacgggggacgacaatatc
accctgtcgaacgcgcgcgtcaaaagcggcgaattcgtcagcaacgtgaaatcggtcggc
tattacggtgccgatttgtacgcggccatgaaccgtcgtcagattccacgcgagaggttc
tacaagccctcgccgatgatgctgagccagccggtgacgaacaaccagaccgtcaaccag
acgatagcgcccgtgttccagcagaagatcgtgcgtccggcggatgacatgtatacggcg
gcgtcgatcatgtaccgcaacgccgctcatctcgtgggaaggctctcaagatga

DBGET integrated database retrieval system