KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1136Help
Entry
Blon_1136         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DctQ DUF997
Motif
Other DBs
NCBI-ProteinID: ACJ52226
JGI: Blon1136
UniProt: B7GQZ6
Position
complement(1321493..1321756)
Genome map
AA seq 87 aa AA seqDB search
MSIEALRRRKRMRRPKPRLSDGQKSALLLAVTFFEGWLVGFAGTHSRIPSPVGTPQWMIT
GSLALAVVLPLVFVGILLKWGGDGTAE
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaggcattgcgcagaaggaagcgtatgcgtcgtccgaagccacggttgtcg
gatgggcagaagtccgcgcttctgctggcggtcacgttcttcgagggttggctggtcggt
ttcgccggcacgcatagtcgcatccccagtccggtgggtacgccgcagtggatgataacc
ggctcgctcgcattggcggtcgtattgccgctcgtgttcgtgggaatcctgttgaagtgg
ggtggcgatggaacagccgagtga

DBGET integrated database retrieval system