KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1158Help
Entry
Blon_1158         CDS       T00794                                 

Definition
(GenBank) Holliday junction DNA helicase RuvB
  KO
K03551  holliday junction DNA helicase RuvB [EC:3.6.4.12]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bln00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Blon_1158
Enzymes [BR:bln01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Blon_1158
DNA repair and recombination proteins [BR:bln03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Blon_1158
    RecFOR pathway proteins
     Blon_1158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvB_N RuvB_C AAA AAA_5 AAA_16 TIP49 AAA_22 AAA_14 Mg_chelatase Sigma54_activat AAA_3 AAA_18 TsaE NTPase_1 Zeta_toxin RNA_helicase AAA_33 IstB_IS21 Sigma54_activ_2 AAA_25 AAA_19 NACHT AAA_24 NB-ARC
Motif
Other DBs
NCBI-ProteinID: ACJ52248
JGI: Blon1158
UniProt: B7GR18
Position
1339636..1340700
Genome map
AA seq 354 aa AA seqDB search
MNETTDYGASNTGANEESLRMVSSQPIGNEPASDEELRPHVLGGFIGQPRLKAQLQLFLD
AARKRDVPPDHILLAGPPGLGKTTLAMIVANELEVPIRVTSGPAVQHAGDLASILSSLDT
GEVLFIDEIHRLPRAAEELLYIAMEDFRVDVMVGKGPGASSIPLTLPRFTVIGATTREGM
LPSPLRARFGFTAHLDFYPHDELQKLIERSANVLGVNLGDGSARELALRSRGTPRIANRL
LRRVRDWAIVHDLIEVRSDDVKEALALYQIDSEGLDRLDIAVLDAIVRNFNGGPVGLNNL
AAMVGEESETVETVCEPYLVREGFLIRTPKGRVATEKAWRHLGITPRDDVSKPF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagacgacggattacggcgcctccaacaccggtgccaacgaggagtcgttacgc
atggtctcctcgcagccgatcggcaacgagccggccagcgatgaggaattgcgcccgcat
gtcctcgggggattcatcggccagccccggctcaaagcccagctgcagctgttcctcgac
gccgcgcgcaagcgggacgtgccgcccgatcatatcctgctcgccggcccacccggtttg
ggcaagaccacgttggccatgatcgtggccaacgagctcgaagtgccgattcgcgtcact
tccgggcctgcggtccaacacgccggcgatctcgcctcgattctcagttcgcttgatacc
ggtgaggtgttgttcatcgacgagatccaccgcctgccgcgcgccgccgaggagttgctg
tacatcgcgatggaggatttccgcgtcgacgtgatggtcggcaagggtccgggcgccagc
tccattccgttgaccctgccgcggttcaccgtcatcggcgccaccacgcgcgagggcatg
ttgccgagtccgttgcgcgcacgcttcggtttcaccgcacatcttgacttctacccgcac
gacgagctgcagaagctcatcgaacgttcggccaatgtgctgggcgtgaatcttggcgac
ggctcggctcgggaactcgcgttgcgttcgcgcggcacgccgcgcatcgccaatcgtctg
ctgcgccgtgtgcgcgattgggcgatcgtgcatgacctgatcgaggtgcggtcggatgac
gtcaaggaggccttggccttataccagatcgattcggagggtcttgaccgcctggacatc
gccgtactcgacgccatcgtgcgtaatttcaatggtgggcccgtgggactgaacaacctt
gcggccatggtgggcgaggagtcggagaccgtggaaaccgtatgcgagccgtatctcgtg
cgtgagggtttcctgatccgcaccccgaaaggccgcgtggccactgagaaggcctggcga
cacctggggattacgccaagggatgatgtcagcaagcccttctag

DBGET integrated database retrieval system