KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1161Help
Entry
Blon_1161         CDS       T00794                                 

Definition
succinate--CoA ligase (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Blon_1161
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Blon_1161
   00640 Propanoate metabolism
    Blon_1161
   00660 C5-Branched dibasic acid metabolism
    Blon_1161
Enzymes [BR:bln01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Blon_1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1341939..1343141
Genome map
AA seq 400 aa AA seqDB search
MDLYEYQARQLLEEQDIPTPSAIFAQNSHEVAEAADAIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAIVESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPESVKRLHIDALGDFDLAAATEMARSIGFYHADVDQAAQILLKMWRVF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNAAFRHGGWERFVDSVVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGSDVKPANFLDIGGGASAA
VMAESLQIVLSDPQVESVFINIYGGITSCVEVANGILDAVAKLGGSKPIVVRFDGNAAAE
GLHILASANKPNIHVSETMEDAAAKAAQLAGEAIQSKEVL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggatctttacgaatatcaggcgcgtcagctgctcgaggaacaggacattcccaccccg
agcgccatcttcgcccagaactcccatgaagtcgcggaagcggcggacgcaatcggctat
ccatgcgtgatcaaggcgcaggtcaagatcggccatcgcggtcaggctggcggcgtcaag
atcgcccacaaccgcgacgaggccattgtcgaatccgagtccattcttccgatgaccata
cacggccacaaggtctccggcgtgctcgtggccgaagccaagaacatcctgcatgagtac
tatgtgtccatctccgtggatcgcacctcgcgcgacttcgatgtgctggccaccgccaac
ggcggcaccgaggtggaggagatcgccaaggagcatccggaatccgtcaaacgcctgcac
atcgacgcgctcggcgatttcgatctggccgcggccaccgagatggcccgcagcatcggc
ttctaccatgccgacgtcgatcaggccgcgcagattctgctgaagatgtggcgcgtcttc
aaagacaacgacgccacactcgtggagatcaaccctctggccaagatcggcgacccggac
gacgagtccaccaagcagctgagcgccttggacgccaagatttccctggacgacaacgcc
gccttccggcatggtggctgggagcgattcgtggattccgtcgtccccgaccccttcgag
cagcgcgcccgtgagcacggactgcattacgtgcatctgcacggcgaggtcggcgtgatc
ggcaacggtgctggactcgtcatgagttccctggacgccgtctccggcgccggcgaggag
cagggcagcgatgtcaaacccgccaacttcctggacatcggcggcggcgcctccgccgcg
gtcatggccgagagcctgcagatcgtcctgtccgacccgcaggtcgaatccgtattcatc
aacatatacggcggcattacttcctgcgtggaggtcgccaacggcattctcgacgccgtc
gccaagctcggcggttccaaacccatcgtcgtgcgcttcgacggcaacgcggcggccgag
ggtctgcatatcctcgcctccgcgaacaaaccgaatatccatgtgtccgaaaccatggaa
gacgcggcggccaaggccgcgcagctcgccggtgaggcgattcagtccaaggaggttctc
tga

DBGET integrated database retrieval system