KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1163Help
Entry
Blon_1163         CDS       T00794                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4153 DUF3937 DPM3
Motif
Other DBs
NCBI-ProteinID: ACJ52253
JGI: Blon1163
UniProt: B7GR23
Position
1344072..1345451
Genome map
AA seq 459 aa AA seqDB search
MKAVIRQWVRGAIVALASMAIYAIALGCYTALMLLVVSMEEGADNLTVGTTSLTQAVVLL
SEGSGFRTDSFTLTITPLMLTILLIWLINALTMRIKAYGPHAYVAGLVVWLGLNEVFRQS
VHLGLVDDQWLVLLKAAIVFSIGFLCAAVPESAKMRAFRDWTRKQVPADIRHCLKIGVAL
AVAILGIYLAIGLITVIVWAVRNHAAVVSLFGLSGMETGSRILTTVAMLIWLPNVMLWAV
SWLFGGGFAIGDLASFTLWLGQSKELPAIPVFGILPEPVSSELWRTVALNAPLAIAALVG
LLAVFLPQGFACRPLNIRNASTRGPVLVSLIYSAGSFCLSAMLISLASTLLFALSNGSLG
DHRLAHIGVDVMASTRVVGHSTALGFTAAWLLALIGTALVFSIGWLVGRINDSRTTAATP
KTVIVRQARSLASQPQESKEEQDDKHEPTDPSGTGLGLS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtgattcgccaatgggtgcggggagccatagtcgctctcgcatccatggcc
atctatgccattgcattaggctgctatacagcgctgatgttattggtcgtctccatggaa
gagggcgccgacaatctcaccgtcggcacaacctcgctgacacaggccgttgtgcttctg
agtgagggatcgggctttagaaccgattcgttcaccctcaccatcacgccattgatgttg
actatactgctgatatggctgatcaatgcactcaccatgcgaatcaaagcatacgggccg
catgcgtatgttgccggattggttgtttggctcgggttgaacgaggtattccggcaatcc
gtacacctaggtcttgtcgatgaccagtggcttgtgttgctgaaagcagccatcgtattc
tcgatcggtttcctatgcgcagccgtaccggaatcagccaagatgcgagcattcagggac
tggactcgcaagcaggtgccggcggacatacgccactgcctgaaaatcggcgtcgccttg
gccgtcgcgatactgggcatatacctggcaattggattgattaccgtcatcgtatgggcg
gtacgcaaccatgccgctgtcgtatcgttgttcggattgtccgggatggaaaccggttca
cgaattctcaccaccgtcgccatgctgatctggctacccaacgtcatgctctgggctgtt
tcctggctcttcggcggcggattcgccatcggtgatttggccagtttcacgttatggctc
ggccaatccaaagagcttcctgcaataccggtattcggtattcttcccgaaccggtcagc
agcgaactatggcgtaccgttgccttgaacgcgcctctcgccatcgctgcgctcgtgggc
ctgctggctgtattcctgccgcaaggattcgcctgcagaccgttgaatatacggaatgcg
tccacccgcggcccagtactggtttcgctgatctactccgctgggtcattctgcctgagc
gcgatgctgatctcactggcatccacattgctgttcgctctgtccaatggatcgcttggc
gatcatcgtctcgctcacattggcgtcgacgtcatggcctccaccagagtcgtcggtcat
tcgaccgcattgggatttaccgcggcatggctactcgcgctgattggcacagcgctcgtt
ttttcgataggctggttggttgggaggatcaatgattcccgcaccaccgccgcgaccccg
aagaccgtcatcgtccgtcaggcgcggtccctggcgtcacaaccacaagaatccaaggag
gaacaggatgacaaacacgaaccgaccgatccgtcgggcactggtctcggtctttcataa

DBGET integrated database retrieval system