KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1166Help
Entry
Blon_1166         CDS       T00794                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
Enzymes [BR:bln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     Blon_1166
Ribosome biogenesis [BR:bln03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Blon_1166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: ACJ52256
JGI: Blon1166
UniProt: B7GR26
Position
1348548..1349318
Genome map
AA seq 256 aa AA seqDB search
MPNAYSRAAKAQDDSNSIRLQKLLAQAGFGSRRKCEDMITEGRVEVDGELVTELGTRVDP
HKQQVRVDGSRVRVNPNHVTLALNKPRKVLSAMDDPKGRYTLRDIVGDKYERIFHMGRLD
YDSEGLILMTNDGELSQHVMHPKYEVEKTYVATLEGKISGTVCRRLVTTGVQLDDGWIKL
DHCAIIDASRDYTMVKVVLHSGKNRIVRRIFGSIGFPVKRLVRTQIGPIKLGDLKPGSYR
VLSQTEVRSLSKEVGL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacgcatattcccgcgctgcgaaagcgcaagacgattccaattccattcgactc
cagaagctgcttgcccaagcgggattcggttcccgccgcaagtgcgaggacatgatcacc
gaaggccgtgtcgaggtcgacggtgaactggtcaccgagctcggaactcgcgttgaccct
cataagcagcaggtgcgcgtagacggttcacgcgtacgcgtcaatccgaaccacgtcact
ctggcactgaacaagccccgcaaggtgctctccgccatggacgatccgaagggacgctac
acgttgcgtgacatcgtgggcgacaagtacgagcgcatcttccacatgggccgtctcgac
tacgattccgagggtcttatcctcatgacgaacgatggcgaactctcgcagcacgtcatg
caccccaagtacgaggtcgaaaagacctacgtcgccacgctggagggcaagatctccggt
accgtgtgccgccgactcgtgaccaccggcgtgcagctcgatgacggttggatcaaactc
gaccactgcgccatcatcgacgcctcccgtgattacacgatggtcaaggtcgtgctgcac
tccggcaagaaccgcatcgtgcgccgcatcttcggttcgatcggtttcccggtcaagcgt
ctggtgcgcactcagatcggcccgatcaaactcggtgatctgaagcccggttcctaccgc
gtgctgtcccagacggaagtccgttcgctgtccaaggaggttggcctgtga

DBGET integrated database retrieval system