KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1172Help
Entry
Blon_1172         CDS       T00794                                 

Definition
(GenBank) DEAD/DEAH box helicase domain protein
  KO
K03727  ATP-dependent RNA helicase HelY [EC:3.6.4.-]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
Enzymes [BR:bln01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Blon_1172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DSHCT DEAD ResIII Helicase_C AAA_22 rRNA_proc-arch Sigma54_activat
Motif
Other DBs
NCBI-ProteinID: ACJ52262
JGI: Blon1172
UniProt: B7GR32
Position
1357088..1359679
Genome map
AA seq 863 aa AA seqDB search
MARHQHHKGNADSQTLSPSQRYASFQKVQRHRASAAARFAESLPFELDGFQTEANDALEA
GSNVLVAAPTGAGKTVVADFAIYLAQERNVKAFYTTPIKALSNQKYHDLVDVYGPDKVGL
LTGDTSINSEADIVVMTTEVLRNMLYERSTTLNALRYVILDEVHYLADRFRGPVWEEVII
HLPKTVKIVGLSATVSNVEDFSNWIASVRGDTKLVISEHRPVPLEQHVIVQADEHTEPEV
LDLYRRDGNGEQTTKLNAELINRLDQLDRKAARRRGEERPDKRKSFGRGRGGKGVKNRAP
KAERHTPRRWAVVDELNFLGMLPGIYFIFSRNGCDQAVEQCINAGLKLTTDEEVTRIRRI
VDEMVEGQLTQEDLKALQFSKFRFALEEGFASHHAGMIALFRQIVERLFEEGLVKMVFAT
ETLALGINMPARCVVVEKLEKFDGTSHVGLTPGEFTQLTGRAGRRGIDTIGHAIVVDHHG
FVPATAAALSSKRVYPLHSSFRPTFNMAVNLLNSSDYETARVTLDQSFAQWEANESAWQL
ESQINTLKNALAGYEQAFACEHGDFKQFMTLRMELSDIEKEGRRKLKHEVFLTDQERSRA
FQNLDQRIRDLRKAEHEHPCRNCPDLQQHLKWGHRWARETRELQRVTDRYDSRTGSVARQ
FDRICDILTGLGYLERHEDAAGHIDMTLTEKGSLLRRIYSEHDLELCEALLAGTFDKLDA
NGLAAVLSSLVYEARRGGDSEPRHYPGGISGPIAIASSKLKGICEDIDILCEDHGLDEMQ
RPDSGILDIMYEWADGGSLGSCLYGTDMTGGDFVRTAKRLADVLQQIAVAQPLPFDGGER
LAGLAHEAADQINRGVVAYSGVD
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcaccaacaccataagggcaatgccgattcccagacgctgagcccttcgcag
cggtacgcatcattccaaaaagtccaacgccatcgggcatccgcagcagcgcgattcgcc
gaatccctgcccttcgaactggacggcttccagaccgaagctaatgatgcgctcgaagcc
ggcagtaatgtactggtcgcggccccaaccggcgccggcaaaaccgtagtggcggatttt
gccatttacctcgcccaggaacgcaacgtcaaagccttctacaccacaccgatcaaggcg
ctgagcaatcagaaataccatgatctggtcgacgtgtacggcccggacaaggtgggcctg
ctcaccggcgatacctcgatcaactccgaggctgacatcgtggtcatgaccaccgaagtg
ctgcgtaacatgctttacgagcgttcaaccacgctgaacgcactgcgctatgtgatcctt
gacgaagtgcactatctggccgaccgattccgcgggcccgtgtgggaggaagtcatcatc
cacctgcccaagacggtcaagatcgtcggcctgtccgccaccgtgtccaacgtggaggat
ttctccaactggatcgcctcggtgcgcggcgacaccaagctggtgatcagcgaacaccgc
cccgtgccgctggaacagcacgtcatcgtgcaggcggacgaacacaccgagcccgaggtg
ctggatctctatcgccgcgacggcaacggcgagcagaccaccaagctcaacgccgaactc
atcaaccggctcgaccagctggaccgcaaggccgcacgccggcgcggcgaggaacgcccc
gataagcgcaagagcttcggcagaggacgtggtggcaaaggcgtcaagaaccgtgccccg
aaagcggaacgccacaccccgcgccgctgggccgtggtggatgagcttaacttcctggga
atgttgcccggaatctacttcatcttctctcgcaacggttgtgaccaggccgtggaacag
tgcatcaacgccggactgaagctcaccaccgatgaggaagtgaccaggattcgccgcatc
gtggatgagatggtggaggggcaactcactcaggaagacctgaaagccctgcagttctcc
aagttccgcttcgcgttggaagaaggcttcgcttcgcaccacgccggcatgatcgctctg
ttccgccagatagtcgaacgattgttcgaagaaggtctggtcaagatggtgttcgccacg
gaaacgctggccttgggcatcaatatgccggcccgttgcgtggtggtcgagaaactcgag
aagttcgacggcactagtcatgtgggcctgactcccggagaattcacgcagctcaccggt
cgtgccggtcggcgcggcatcgacaccatcggccacgccatcgtggtcgaccatcacggt
tttgtgcccgccacggccgccgcgttgtcatccaagcgtgtctacccgttgcactccagc
ttccggcccacgttcaacatggccgtgaacctgctcaactccagcgactacgagaccgcg
cgcgttaccctggaccagtcgtttgcccagtgggaggccaacgaatcggcctggcagttg
gaatcgcagatcaacacactgaagaacgcgctggccggatacgaacaggcgttcgcatgc
gaacacggcgacttcaaacagttcatgaccctgcgtatggagctgagcgatatcgagaag
gaaggccgccgcaaactgaagcacgaagtgttcctgaccgatcaggagcgttcacgcgcc
ttccagaacctcgaccagcgcatccgcgatttgcgcaaggcggaacacgagcatccatgc
cgtaattgcccggacctccagcagcacctcaagtggggccaccgctgggcccgcgagacc
cgcgaactgcagcgcgtcaccgatcgctacgactcccgtaccgggtccgtggcacgtcag
ttcgatcgcatctgcgatattctcaccgggcttggttacctcgaacgtcatgaagatgcg
gccggccacatcgacatgacgttgaccgagaaaggctcgctgctgcgccgcatctatagt
gaacatgacctggaactgtgcgaggcgctgctcgccggcacgttcgacaagctcgacgcc
aacggactggccgctgtgctctcttcactggtatacgaggccagacgagggggagacagt
gaaccgaggcactacccgggcggcatctccgggcccatcgccatcgcttcgtccaagctc
aagggcatctgtgaagacatcgatatcctgtgcgaggatcacggtctggacgagatgcag
cggccggactccggcatactcgacatcatgtatgaatgggcggatggcggttcgctggga
tcgtgcctgtacggcaccgacatgaccggcggcgacttcgtacgcactgccaaacgactg
gctgacgtgctgcagcagatcgctgtcgcccagccgctgccgttcgacgggggagagcgg
ctggcaggcctcgcccacgaagcggccgaccagatcaatcgtggcgtggtggcctactcc
ggcgtggactga

DBGET integrated database retrieval system