KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1179Help
Entry
Blon_1179         CDS       T00794                                 

Definition
(GenBank) transposase, IS605 OrfB family
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1363810..1365132
Genome map
AA seq 440 aa AA seqDB search
MRWLCDGWRCRYNQLRSRRTKWDKNLGMSIPLGGKPDMRSDRQVRLECSWFAAIPAMVLQ
SPNRIENTDWWSANKRRKTLKKKHRNPGMTPRFKKRRDDLYFVCWHNKGANANYRQLNRR
HGEVVITGQNPGAYRLDGQRCRYSIHIRVRVSQPIRDYTSVDVNWTRRTLVFVNDPLPIG
RERTGAMVGLDRGCVHTLATSDNRFIDLPKDRLNHIDKEIRRRQKAQARRIAMSGETVKQ
YRRHASRTYERTGREISRLYAKAHRIIDDWQHKTTSMLVREYDLIVLEDLNLQGMSRKAK
AKPDPDRPGAFLPNGQSAKRELNRSLRAASLAGIVGKLEYKTRLTGRNRLIFVNPAYTSQ
TCSKCGHCAKENRESQADFECRQCHARMNADLNAANNILKRGLNHLLGLDEAGHAETEPD
AQPAYRGKDASAMTCETSTR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcgttggctgtgcgacgggtggcgttgccgatacaaccagttgcgttcccgtagaacc
aaatgggataaaaaccttggcatgagcattccgttgggcgggaagccggacatgcgctcc
gaccgtcaggtaagactggagtgctcatggttcgcagccatccccgcaatggtgctgcaa
tccccgaacaggatagagaacacggactggtggagcgcgaacaaacgccgcaaaacattg
aagaagaagcatcggaacccgggcatgacgccccggttcaaaaaacggcgtgacgacctg
tatttcgtctgctggcacaacaagggcgcgaacgcgaactaccgtcagttgaaccggcgt
cacggcgaggtcgtcatcaccggacagaaccccggcgcatatcgtctggacggccaacgg
tgccggtacagcatccacatccgcgtccgcgtcagccaacccatccgcgactatacgagc
gtcgacgtgaactggacgagacgaacactcgtgttcgtcaacgacccgctgccgataggc
cgtgagcgcacgggtgcgatggtcggattggacaggggttgcgtccacacgctcgccacg
tccgacaatcgtttcatcgacctccccaaagaccggttgaaccatatcgacaaggagata
cgccgccgtcagaaggctcaggcgcgacgaatcgccatgtccggcgaaaccgtcaaacaa
taccggcgtcatgcgagccgcacctacgagcgtaccggtcgggaaatcagccgactgtac
gcgaaggcacaccgcatcatagacgactggcagcacaagaccaccagcatgctagtccgc
gaatacgacctcatcgtattggaagacctcaacctgcaaggcatgagccgcaaagccaag
gcgaaaccagacccggacaggccgggcgcgtttctacccaacggacagtcggcgaaacgt
gaactcaaccgcagcctacgcgccgcaagcctcgccggaatcgtcggcaaactcgaatac
aagacccggctgaccggacgaaaccgtctcatattcgtcaaccccgcgtacacgtcgcag
acatgcagcaagtgcgggcattgcgccaaggagaaccgcgaaagccaagcggacttcgaa
tgcaggcaatgccacgcgcgcatgaacgctgacctgaacgcggccaacaacatcctcaaa
cggggattgaaccatctcctcggcttggacgaagccgggcacgccgaaacggagccagac
gcccaacccgcctatcgcgggaaggacgcttccgccatgacgtgcgaaacctcaacacga
taa

DBGET integrated database retrieval system