KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1219Help
Entry
Blon_1219         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52308
JGI: Blon1219
UniProt: B7GR78
Position
1401465..1401962
Genome map
AA seq 165 aa AA seqDB search
MTCPSAGRRATSPSPGRRAAEPEAMRRGRMRAGMHENIIGWENLPASLLARIRDGIVAQR
DGDEWTRFRPALAGRTDAGEPYIVDSDCVDHWVGDGSAFPDPDTPLPEAVRRDPMPGDLI
RLHKTDDPAIADIGRYEGRSAMAGWMTDNGPYYAREWTLDRVVEQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgacatgcccatcggccggcaggcgcgccacgtcgccctcccctggacggcgggccgcg
gaaccggaggccatgcgtcggggacgcatgcgcgcgggcatgcacgagaacatcatcggt
tgggagaacctgcccgcaagcctcctcgcccgcatccgggacgggatcgtggcccaacgg
gacggcgacgaatggacgcgcttccgccccgcattggccggcaggaccgatgcgggcgaa
ccctacatcgtggactcggactgcgtcgaccattgggtcggcgacggctccgcgttcccc
gacccggacacgccattgcccgaggccgtgcggcgcgaccccatgccgggcgacctcatc
cgcctccacaagaccgacgacccggccatcgccgacatcggccgctatgagggccggtcg
gcgatggccgggtggatgaccgacaacgggccctactacgcgcgcgaatggacgctcgac
agggtcgtcgaacaataa

DBGET integrated database retrieval system