KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1224Help
Entry
Blon_1224         CDS       T00794                                 

Definition
(GenBank) hypothetical protein
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACJ52313
JGI: Blon1224
UniProt: B7GR83
Position
1407531..1407905
Genome map
AA seq 124 aa AA seqDB search
MRSGRTHTGGMTPIAILFWPAAGILLRRLVPAMLLDAGRERWARAAGPGPWPARLALFAA
VLAPFAAGGVWAPRLMLLAVGYAAGWDAIPRPHHAPRILRAGFGKEGLHNRSVPLPSIRR
IGRR
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccggacggacgcatacgggaggcatgaccccgatcgccatcctgttctggccg
gccgcgggaatcctgctgcgccggctcgtccccgccatgctcctggacgcgggccgggaa
cggtgggcgcgggcggcgggccccggcccatggcccgcgcgtctcgccctgttcgccgcc
gtgctcgccccgttcgccgccggcggcgtgtgggcgccgcgcctcatgctcctggccgtc
ggctacgcggccggctgggatgccatcccccgtccgcatcacgctcctcggatacttcgg
gcaggtttcgggaaagaaggccttcataatcgaagcgttcctcttccatcaattcgccga
attggtcggaggtga

DBGET integrated database retrieval system