KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1371Help
Entry
Blon_1371         CDS       T00794                                 

Definition
bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Blon_1371
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Blon_1371
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Blon_1371
Enzymes [BR:bln01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Blon_1371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1538538..1540625)
Genome map
AA seq 695 aa AA seqDB search
MSVLDELVAGALEDQRTRELTVSLEDVKKAALAAPAPIDATRWLKRADGIPVIAEIKRAS
PSKGHLSDIPDPAVLAREYEKGGASAISVLTEGRKFLGSLDDFDKVRAAVHIPVLRKDFI
VTDYQIFEARAHGADLVLLIVAALDDAQLKHLLDLAHELSLTVLVETHTREEIERARKAG
AKVIGINARNLKNLKVDVNKYNELAADLPDDVIKVAESGVFGAVEVEDYARAGADAVLVG
EGVATADDHELAVERLVKAGAQVKASETTPLSEHQGPFWGQFGGRYVPEALITALDELER
VYTQAKADPEFHKEFMTLQQRYVGRPSPLTEAPRFAALVKEKTDLDARIFLKREDLNHTG
AHKINNALGQALLVKRMGKTRMIAETGAGQHGVATATVCAMLGLKCRIYMGQIDARRQAL
NVARMRMLGAEVVEVTLGDKILKDAINEALRDWVTNVKDTHYLLGTVAGPHPFPAMVRDF
QKIIGEEAKQQLQDWYGIDHPDAICACVGGGSNAIGVMNAFLDDERVNLYGYEAGGNGPE
SGKHAIRFAPGTGQLGMFQGAKSYLLETDEGQTLDTYSISAGLDYASVGPEHAWLKDIGR
VNYSWATDEEAMNAFRDLSQSEGIIPAIESSHAVAGAYKAAADLKAKGYDKAVMIVNISG
RGDKDMATAGKWFGYLTDDQAAALDVTGVNGNTVA
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttttggacgaactggtggcgggagcgctggaggatcagcgcacccgtgagctc
accgtatcgcttgaggacgtgaagaaggccgcgctggcggccccggctccgattgacgcg
acacgatggcttaagcgcgccgacggcatccccgtgatcgccgagatcaagcgcgcgtct
ccgtccaagggccacctctccgacatcccggacccggccgtactggcccgcgaatacgag
aagggcggcgcaagcgccatctccgtgctcaccgaaggccgcaaattcctcggcagcctt
gacgatttcgacaaggtccgcgccgccgtgcacattccggtgctgcgcaaggacttcatc
gtcaccgactaccagatcttcgaagcccgcgcccacggcgccgacctggtgctgctcatc
gtcgccgcattggacgacgcccagctcaagcacctgctggatctggcgcacgagttgagc
ctgaccgtgctggtcgaaacgcacacccgcgaggaaatcgaacgcgcccgcaaggccggt
gccaaggtgataggcatcaacgcgcgcaacctgaagaacctcaaggtggacgtgaacaaa
tacaacgaactcgcggccgatctgcccgatgacgtcatcaaggtggcggaatccggcgta
ttcggggcggtcgaggtcgaagactacgcccgcgcgggagcggacgcggtactggtcggt
gaaggcgtggccaccgctgatgatcatgaacttgcagtggaacgactagtaaaggcagga
gcacaagtgaaagcatccgaaacaaccccgctcagcgaacatcagggaccgttttgggga
cagttcggcggccgctatgtgcccgaggccctcatcaccgccctcgacgagctggagcgc
gtgtacacgcaagccaaggccgaccccgaattccacaaggaattcatgacgctccagcag
cgttacgtgggccgcccgagcccgctgaccgaagccccgcgcttcgccgcactcgtcaag
gagaagaccgatctcgacgcccgtatcttcctcaagcgcgaggacttgaaccacaccggc
gcgcacaagatcaacaacgcgctcggacaggccctgctcgtcaagcgcatgggcaagacc
cgcatgatcgcggagaccggcgccggccagcacggcgtggccaccgccaccgtgtgcgcc
atgcttggcctcaagtgccgcatctacatgggccagatcgacgcccgccgccaggccctg
aacgtggcccgcatgcgtatgctcggcgccgaagtggtcgaggtgaccctcggcgacaag
attctgaaggacgccatcaacgaggccctgcgtgactgggttaccaacgtcaaggacacg
cactacctgctcggcaccgtcgcaggcccgcacccgttcccggctatggtgcgcgacttc
cagaagatcatcggcgaggaagccaagcagcagctccaggactggtacggcatcgaccat
ccggacgcgatctgcgcctgcgtgggcggcggctccaacgccatcggcgtgatgaacgcc
ttcctggacgatgagcgcgtgaacctctacggctacgaagccggcggcaacggccccgaa
tccggcaagcacgccatccgcttcgcccccggcaccggccagctcggcatgttccagggt
gccaagagctatctgctggaaaccgacgaaggccagacgctcgacacctactcgatctct
gcaggccttgactacgcttccgtggggccagagcacgcatggctcaaggacatcggccgc
gtgaactacagctgggccaccgatgaggaggccatgaacgccttccgcgacctgagccag
agcgagggcatcatccccgccatcgaaagctcgcacgccgtggccggcgcgtacaaggcc
gccgcggatctgaaggccaagggctatgacaaggccgtgatgatcgtgaacatctccggc
cgaggcgacaaggacatggccaccgccggcaagtggtttggctacctgaccgacgatcag
gccgccgcgcttgatgtgaccggtgtcaacggcaacaccgttgcctga

DBGET integrated database retrieval system