KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1622Help
Entry
Blon_1622         CDS       T00794                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Blon_1622
Enzymes [BR:bln01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Blon_1622
    3.5.1.-  
     Blon_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1773927..1774619
Genome map
AA seq 230 aa AA seqDB search
MAMMRAIARRVRDNIQNESKAIGGMTMTKALIVVDVQPTFCEGGELGVEGGNAVAERIAD
YVNAHRSEYAYIATTQDWHIEPGAHWSAEPDFVDTWPKHGAAGTPNAELHTAIKALNIQH
HFKKGQYSAAYSGFEGIEDNTDRIQTREEVTAEQSAGKTLANALKAAGVSRVDVVGIAES
HCVKDTALDAGKLGFEVTVFEGLTVPVSEELGVAARKQMTAASITLAESR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatgagagcaatcgcacgtcgagttcgagacaatattcaaaacgaatccaag
gcaatagggggaatgacgatgaccaaggcactgattgtggtggatgtgcagccgacgttc
tgtgaaggcggcgaactgggagtcgaaggcggcaacgcggtcgccgagcggatcgccgat
tatgtgaacgcgcatcgcagcgagtacgcgtatatcgcaaccacgcaggactggcatatc
gagccgggcgcgcactggtcggcggaaccggatttcgtggacacgtggccgaagcatggt
gcggccggcacgccgaacgccgaattgcatacggcgatcaaggcgctgaatatccagcat
catttcaagaagggccagtattcggcggcatattccggttttgagggcatcgaggacaat
accgaccgtatccagacccgcgaggaggtcacggccgagcaatccgccggcaagacgctg
gccaatgcgctgaaggccgccggcgtgagtcgcgtggatgtggtgggcatcgccgaatcg
cattgcgtcaaggacaccgcgctcgatgccgggaagcttggtttcgaggtcaccgtgttc
gagggcctgaccgtaccggtcagcgaggagctcggtgtcgctgcccgcaaacagatgacg
gcggccagcatcacattggccgagtcccgctga

DBGET integrated database retrieval system