KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1729Help
Entry
Blon_1729         CDS       T00794                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K22306  glucosyl-3-phosphoglycerate phosphatase [EC:3.1.3.85]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Brite
Enzymes [BR:bln01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.85  glucosyl-3-phosphoglycerate phosphatase
     Blon_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ACJ52804
JGI: Blon1729
UniProt: B7GSX4
Position
1896987..1897685
Genome map
AA seq 232 aa AA seqDB search
MTNHVRSIFLIRHGRTSYNAAHKLQGQVDIPLDAVGEWQVKQTATALKSLYVDRRPEIDN
RFIVCSDLKRAHATAQAFADVLGGIEPVDDPRIRERSFGDWDGLAVAELAERYPEDFRSW
MESRGGELKYGAEPKEAVGKRGMEALEDWSTRAGDDTDLFVFSHGAWIAQTLQTLLGISA
IDPTFSTVVSLRNAHWVCLVPMDNPDGTVRWRLLDYNHGPAIADTDEWERER
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcatgttcgttccatttttcttattcgtcatggacgcacttcctataacgcc
gcccacaagctccaaggccaggtcgatattccgctggacgccgtgggtgaatggcaggtc
aagcagaccgccacggccttgaaaagcctgtacgtcgatcgtcggccggaaatcgacaat
cgattcattgtctgctccgatttgaagcgtgcgcacgccaccgcgcaggctttcgccgac
gtattgggtggaatcgagcccgtcgatgatcctcgcattcgtgaacgcagcttcggggat
tgggatggccttgccgtggctgaactggccgaacgctaccctgaggacttccgttcctgg
atggagtctcggggcggtgaactgaagtatggtgccgaacccaaggaagccgtaggcaaa
cgcggtatggaggctcttgaggactggtccacgcgtgccggagacgacacggacctgttc
gtgttctcgcacggcgcatggatcgcgcagacattgcagaccctgttgggcatttccgcg
atcgatccgaccttctccacggtggtctcattgcgcaatgcgcactgggtgtgcttggtg
ccgatggacaatcctgatggcactgtgcgctggcgtctgctggactacaatcacggtccg
gccatcgccgacaccgacgagtgggagcgcgaacgctga

DBGET integrated database retrieval system