KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1761Help
Entry
Blon_1761         CDS       T00794                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Blon_1761
Enzymes [BR:bln01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Blon_1761
Exosome [BR:bln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Blon_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1934402..1936654
Genome map
AA seq 750 aa AA seqDB search
MAKETKIKEDTVTVPVAQGDLDAVSNAEFYNPHGVLGGHLGIGKHADTATIRVLRPLAKS
VTILTQDGEYPMTHEYNGVFVTTVPASGTKKQPTIPDYRVRTEWESGAVLIEDDPYRYMP
TVGDMDTYLFGEGRHEKLWEALGAHVLRYDDPMGGVDGTPGEQVVGTAFSVWAPNAHAVR
VVGNFNAWDGRRHAMRELGSSGVWEIFIPGIGAGETYKFQILNANYTWEMKADPMERQHE
VPPNTASIVTESTYEWNDDAWMQHRRTTNPHDGPVSIYEVHAGSWKQGLTYRDLAKQLVD
YVRQEGFTHVEFMPLAQHPFSGSWGYQVTGYYAVDSRLGSPDDFRYLVDQFHQAGIGVIM
DWVPAHFPKDAFALGRFDGTPLYEDPDPLRGEHPEWGTYVFNFGRREVRNFLVANALFWL
EDLHVDALRVDAVSSMLYLDYSREPGQWRPNIYGGRENLEAIDFLKEATATAYKNNPGVM
MIAEESTAWPGITAPTSAGGIGFGMKWNMGWMHDTLEYLHEEPINRKWHHNEITFSMVYA
YSEHYVLPISHDEVVYGKGSLYGKMPGDGWQKLAGVRSMFAYQWAHPGKKLSFMGNELAQ
WGEWDHDASIDWDCLNWQEHRQVQTMVADLNAFYKAHPALWSQDFDPAGFQWLTSDDADH
NTLSFLRIGTKGETLAVVVNFSGEAWSDYQVALPTGGKWTEVFTTDDAKYGGSDIHNGTF
EAVEGEYHSRPFSAKITVPALGVVFLKPED
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaacgaagatcaaggaagataccgtcaccgtgcctgtcgcccaaggcgac
ctcgatgcggtgagcaatgctgaattctacaaccctcacggagttctcggcgggcatctc
ggcatcggcaagcatgccgacaccgccacaatccgtgtgctgcgtccgcttgccaagtcc
gtgaccatcctcacccaggatggtgaatacccgatgacccacgaatacaacggcgtgttc
gtgactaccgtgccggcttccggcaccaagaagcagcccacgattcccgactaccgcgtc
aggaccgagtgggaaagcggcgcagtgctcattgaggacgacccataccgttatatgccc
acagtcggcgacatggacacctatctgttcggcgagggccgtcacgagaagctctgggag
gcgcttggcgcgcatgtgctgcgctatgacgatccgatgggcggcgtagacggcacgcct
ggcgaacaggtggtaggcaccgcgttctccgtgtgggccccgaacgctcacgccgtgcgc
gtggtcggtaacttcaacgcctgggatggccgtcgtcatgccatgcgcgagctcggctcc
tccggcgtgtgggaaatcttcatccccggaatcggcgcgggcgagacctacaagttccag
atcctgaacgccaattacacgtgggagatgaaggctgacccgatggagcgtcagcacgag
gttccgccgaacaccgcctccatcgtcaccgaatccacctacgagtggaacgatgacgcc
tggatgcagcaccgccgcaccaccaacccgcatgatggcccggtctccatctatgaggtg
cacgccggcagctggaagcagggactgacctaccgtgacctggccaagcagctcgtggac
tacgtcaggcaggaaggcttcacccacgtggagttcatgccactggcccagcacccgttc
tccggctcctggggctatcaggtcaccggctactatgcggtggactcccgtctcggttcc
cccgacgacttccgttaccttgtcgaccagttccatcaggccggcatcggcgtgatcatg
gactgggtgcccgcccacttcccgaaggacgccttcgcgctcggccgcttcgacggcacc
ccgctgtacgaggacccggacccgctgcgcggcgaacaccccgagtggggcacctatgtg
ttcaacttcggacgccgcgaagtacgcaacttcctggtggccaacgccctgttctggctc
gaggacctgcacgtcgacgcactgcgcgtggatgccgtcagctccatgctctacctcgac
tacagccgcgaacccggccagtggcgtccgaacatctacggcggacgcgaaaacctggag
gccatcgacttcctcaaggaagccaccgccaccgcgtacaagaacaaccccggcgtcatg
atgatcgccgaagagtccaccgcatggccgggcatcaccgcccccacctccgccggaggc
atcggcttcggcatgaagtggaacatgggctggatgcacgacaccctcgagtatctgcac
gaggagcccatcaaccgcaagtggcaccacaacgaaatcaccttctccatggtgtacgcc
tactccgaacactacgtattgcccatcagccacgatgaagtcgtgtacggcaagggctcc
ctgtacggcaagatgccgggcgatggctggcagaagctagccggcgtgcgttcgatgttc
gcctatcagtgggctcacccgggcaagaagctctccttcatgggcaacgagctggcccag
tggggcgagtgggatcacgacgcctccatcgattgggattgcctgaactggcaggagcac
cgtcaggtccagaccatggtcgccgaccttaacgccttctacaaggcgcatccggcactt
tggagccaggacttcgatccggccggcttccagtggctgaccagcgacgatgcagaccac
aacacgctgagcttcctgcgcatcggcaccaagggcgagaccttggccgtggtggtcaac
ttctccggtgaagcctggtccgattaccaggtggcgctgcccaccggcggcaagtggacc
gaagtgttcaccaccgatgacgccaagtacggcggctccgacatccacaacggcaccttt
gaagcggtcgagggcgaatatcattcgcgtccgttctcggcgaagatcaccgttccggct
ctgggagttgtattcttgaagccggaagactga

DBGET integrated database retrieval system