KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1843Help
Entry
Blon_1843         CDS       T00794                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Blon_1843
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Blon_1843
Enzymes [BR:bln01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Blon_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2010669..2011874
Genome map
AA seq 401 aa AA seqDB search
MATICALAVVLAGVAAYEWHVGWFAKSTSDGNTAAPQTSRTSVLPRTDAPSPKKNDAPAA
QAQRAVSAMTLEERVGQLVMVPLFAGSDPSSLASTIADEHIGSAILIGNWNTGVDTVKTA
TAQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQ
LAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRGAQVGAA
VKHYPGLGAVSGNTDFTTEGILDTTTTLDGAEAGAFDQAITKADPAMVMMSLATYQSIDP
NNPAVFSSTIIDGHIRNALKYTGVVISDSISAEALSSYDVSQLGVKLVEAGGDMSCIGQT
DYVKPVVDGLNERAKSDPAFASKVTAAATRVMTLKIKMGLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacaatatgtgctttggcagtggtgttggccggcgtggcagcctacgaatggcat
gtcggatggttcgccaaatccacatcagacggcaacaccgccgctccccagacctcccgg
acaagtgtgttaccacgcaccgacgctccttccccgaagaagaacgacgccccggccgca
caagcccaacgtgcggtatccgccatgacacttgaggaacgtgtgggacagttagtgatg
gtgccgttgttcgccggttccgatccctcctcgttggcttcaacaatcgccgacgagcac
attggctcggccattctcattggcaattggaataccggcgtcgatacggtcaagaccgcg
accgcgcaactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcag
gagggtggtcaggtacagcatctgactggtaccggtttcgacacaatgcccagtgccgtt
gagcagggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaa
ttagctgctgctggcataaatgtcgatttggcaccggtgctcggcacggtggtgggcgat
cgtgcctcgaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggt
aacgccgagcatggcatcgccgttattgagggtttgcgaggcgctcaggtcggtgcggcg
gtcaaacattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggc
attctggatacgaccaccacgttggacggggccgaggcaggtgcctttgaccaggcgatc
accaaggccgatcctgcaatggtgatgatgtcgttggccacgtatcaatccatcgatccg
aataatccggcggtgttttcttctacgattatcgacggccatattcgcaacgccctgaaa
tatacgggcgtggtgatttcggattcgatatctgccgaagcgttaagcagctacgatgta
agccaattgggagtaaagctcgtcgaggcgggcggcgacatgtcctgcatcggtcagacg
gattacgtaaagccagttgtggacggcctcaacgaacgggcgaagtccgatccggctttc
gcttcgaaagtgacggcggcggcgactcgcgtaatgacattgaaaatcaagatgggactg
gcctga

DBGET integrated database retrieval system