KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1843Help
Entry
Blon_1843         CDS       T00794                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bln00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bln00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2010669..2011874
Genome map
AA seq 401 aa AA seqDB search
MATICALAVVLAGVAAYEWHVGWFAKSTSDGNTAAPQTSRTSVLPRTDAPSPKKNDAPAA
QAQRAVSAMTLEERVGQLVMVPLFAGSDPSSLASTIADEHIGSAILIGNWNTGVDTVKTA
TAQLQGYAPAGNRLIIATDQEGGQVQHLTGTGFDTMPSAVEQGTMSADALRQSAGTWGSQ
LAAAGINVDLAPVLGTVVGDRASNAPIGALDRDFGLDAAGNAEHGIAVIEGLRGAQVGAA
VKHYPGLGAVSGNTDFTTEGILDTTTTLDGAEAGAFDQAITKADPAMVMMSLATYQSIDP
NNPAVFSSTIIDGHIRNALKYTGVVISDSISAEALSSYDVSQLGVKLVEAGGDMSCIGQT
DYVKPVVDGLNERAKSDPAFASKVTAAATRVMTLKIKMGLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggcgacaatatgtgctttggcagtggtgttggccggcgtggcagcctacgaatggcat
gtcggatggttcgccaaatccacatcagacggcaacaccgccgctccccagacctcccgg
acaagtgtgttaccacgcaccgacgctccttccccgaagaagaacgacgccccggccgca
caagcccaacgtgcggtatccgccatgacacttgaggaacgtgtgggacagttagtgatg
gtgccgttgttcgccggttccgatccctcctcgttggcttcaacaatcgccgacgagcac
attggctcggccattctcattggcaattggaataccggcgtcgatacggtcaagaccgcg
accgcgcaactccaaggatatgcgccggccggcaatcgtctcatcatcgccaccgatcag
gagggtggtcaggtacagcatctgactggtaccggtttcgacacaatgcccagtgccgtt
gagcagggcacaatgtccgctgacgcattgcgtcaatcggcaggcacgtggggttcgcaa
ttagctgctgctggcataaatgtcgatttggcaccggtgctcggcacggtggtgggcgat
cgtgcctcgaatgctccgattggcgcgctggatcgtgatttcggattggatgcggccggt
aacgccgagcatggcatcgccgttattgagggtttgcgaggcgctcaggtcggtgcggcg
gtcaaacattatcctgggttgggcgcggtaagcggcaataccgacttcaccaccgaaggc
attctggatacgaccaccacgttggacggggccgaggcaggtgcctttgaccaggcgatc
accaaggccgatcctgcaatggtgatgatgtcgttggccacgtatcaatccatcgatccg
aataatccggcggtgttttcttctacgattatcgacggccatattcgcaacgccctgaaa
tatacgggcgtggtgatttcggattcgatatctgccgaagcgttaagcagctacgatgta
agccaattgggagtaaagctcgtcgaggcgggcggcgacatgtcctgcatcggtcagacg
gattacgtaaagccagttgtggacggcctcaacgaacgggcgaagtccgatccggctttc
gcttcgaaagtgacggcggcggcgactcgcgtaatgacattgaaaatcaagatgggactg
gcctga

DBGET integrated database retrieval system