KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_1915Help
Entry
Blon_1915         CDS       T00794                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
bln00010  Glycolysis / Gluconeogenesis
bln00071  Fatty acid degradation
bln00350  Tyrosine metabolism
bln00625  Chloroalkane and chloroalkene degradation
bln00626  Naphthalene degradation
bln01100  Metabolic pathways
bln01110  Biosynthesis of secondary metabolites
bln01120  Microbial metabolism in diverse environments
bln01130  Biosynthesis of antibiotics
bln01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Blon_1915
  Lipid metabolism
   00071 Fatty acid degradation
    Blon_1915
  Amino acid metabolism
   00350 Tyrosine metabolism
    Blon_1915
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Blon_1915
   00626 Naphthalene degradation
    Blon_1915
Enzymes [BR:bln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Blon_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ACJ52987
JGI: Blon1915
UniProt: B7GU41
Position
complement(2092797..2093840)
Genome map
AA seq 347 aa AA seqDB search
MTEMMKAAIFVEPGKMAVEEVPKATREQDDDIVIRVVRTCVCGSDLWFFRGLSGQAAHSQ
VGHESIGVVEEVGAAVESVKPGDFVVVPFPYSCGKCPVCKAGFESVCPHGGYFSACQAEY
LRVPEADGTVVKVPGSPEDYSDEQLASLLTISDVMSTGYHAAASAEVKPGDTAVVMGDGA
VGLCGVIAAKMLGAKRIIAMSRHEDRAALAREFGATDIVPERGQEAIDKVLGMTGGYGAD
AVLECVGSKQSFDTAIGLIRRGGVIGRVGLPHDVEISAEGTFYGNIGIKGGPAPVRHYDL
DCGLLDAVLKGEINPGRVFTDEYDLDHIQDAYEAMDQRKVIKALIRF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaatgatgaaagccgcgattttcgtggagcctggcaagatggccgtggaagaa
gtgccgaaggcgacgcgtgaacaggatgatgacatcgtgatccgcgtggtgcgcacgtgc
gtgtgtggctctgatttgtggttcttccgtgggctgagcggacaggccgcgcacagccag
gtgggtcacgagtccatcggtgtggtcgaagaggttggcgcggcggtcgaatccgttaag
ccaggtgatttcgtggtcgtgccattcccgtacagctgcggcaagtgcccggtatgcaag
gccggcttcgaatccgtgtgcccgcacggcggctacttctccgcttgtcaggctgaatac
ctgcgtgtgcccgaggcggacggcaccgtggtcaaggtgcccggttcaccggaagattat
tccgatgagcagctcgcatcgctgctgaccatttccgatgtgatgtccaccggttatcac
gcggcggcttctgccgaggtcaagcccggtgacaccgccgtggtcatgggcgatggtgca
gtcggcctgtgcggtgtgattgccgctaagatgctcggtgcgaaacgcatcatcgccatg
agccgtcacgaggatcgcgcggcgctcgcccgcgaatttggtgcgactgatatcgtgccc
gagcgcggccaagaagctattgacaaggtgctaggaatgaccggcggttacggtgccgac
gcagttctcgaatgcgtgggctccaagcagtccttcgacacggcgattggcctgattcgc
cgcggtggcgtgatcggccgtgtgggcctgccgcatgacgtggagatcagcgccgaaggc
acgttctacggcaacatcggcatcaagggcggcccggcccccgtgcgccactacgacctt
gactgcggactgctcgacgcggtgctcaagggcgaaatcaaccccggccgcgtgttcacc
gacgaatacgacctcgaccatatccaagacgcctacgaggcgatggaccagcgcaaggtc
atcaaggcgctgatccggttctag

DBGET integrated database retrieval system