KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2123Help
Entry
Blon_2123         CDS       T00794                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bln00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2344853..2347015
Genome map
AA seq 720 aa AA seqDB search
MRARRDFAWPKLLTADGRGIAFGGDYNPDQWPEDVWDDDIRLMGQAGVNTVALAIFSWDR
LQPTEDHWNFDWLDRIIDKLGQAGIAVDLASATATAPLWLYENHPEVLPRDKYGHPVNAG
SRQSWSPTSPVFKEYALTLCRKLAERYGTNPYVTAWHMGNEYGWNNRDDYSDNALEAFRA
WCRRKYGTIDALNQAWGTTFWGQEMTGFDEVLIPRFMGADSMVNPGQKLDFERFGNDMLL
DFYKAERDAIAEICPDKPFTTNFMISTDQCCMDYAAWAEEVNFVSNDHYFHEGESHLDEL
ACSDALVDSLALGKPWYVMEHSTSAVQWKPLNTRKRNGETVRDSLAHVAMGADAINFFQW
RASAFGAEAFHSAMVPHAGENTKLFRQVCELGATLQALADAGVQGSELAHADTAILFSAE
SEWATRSETLPSMKLNHWHDVRDWYRAFLNAGARADIVPLAYDWSSYKTIVLPTVLMLSD
ADTRRLAGFVQDGGRVVVGYATGLLDERFHTWLGGYPGAGDGLLRSMLGVRGEEFNILGT
ETEDEPSEIRLASTGDSPTMDGAVTRLWQNDVTVAGPHVQVLAAYAGEEANEWELDGTAA
ITRNTYGEGEAYFLGCDLGVSDLTRFVGGWLAARPQDGRQPEANLRSPASGVTSDVLHTV
RQSDDAIFDFYLTRGKSDVELRDIAGEPIVLFRAERGSDGGAYTVHRNGVLVMKRPNPSV
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgcgcgacgtgacttcgcatggccaaaactgctgaccgcggacggacgcggcatc
gccttcggcggcgactacaatcccgaccaatggccggaggacgtctgggatgacgacatc
cgcctgatgggccaggccggcgtcaacaccgtggcccttgccatcttcagctgggatcgc
ctccagcccaccgaagaccattggaatttcgactggctcgatcgcatcatcgacaagctc
ggccaggccggcatcgcggtcgatctggcatccgcgacggcgaccgcgcccctgtggctc
tacgagaaccatcccgaggttcttccgcgagacaagtacggtcacccggtcaacgccggt
tcgcgccaatcctggagcccgaccagcccggtgttcaaggaatacgcgctaaccctatgc
cgcaaactcgccgaacgctacggcaccaacccgtatgtgacggcatggcatatgggcaac
gaatacgggtggaacaaccgcgacgactactccgacaatgcgctcgaagccttccgcgca
tggtgccgccgcaagtacggcaccatcgacgcgctcaaccaagcgtggggcaccacgttc
tggggacaggagatgaccggtttcgacgaagtcctcatcccacggttcatgggcgccgac
tcgatggtcaatcccggtcagaagcttgattttgaacggttcggcaacgacatgctgctt
gacttctataaggccgaacgtgacgcgatcgccgaaatctgccccgacaagccgttcacc
acgaacttcatgatctccaccgaccaatgctgcatggactacgccgcttgggcggaggaa
gtgaatttcgtgtcgaacgaccactacttccacgaaggcgagtcccacctcgacgagctg
gcctgttccgacgcgctcgtggattcgctggcgctcggcaaaccatggtacgtcatggaa
cattccacttcggcggtgcagtggaaacctctgaacacccgcaaacgcaacggggaaacg
gtgcgcgactccctggcccacgtggccatgggcgccgacgccatcaacttcttccaatgg
cgcgcatccgcgttcggcgccgaagcgttccattccgccatggttccgcacgccggcgag
aacacgaaactgttccgtcaggtatgcgaactgggcgcgacgttgcaagcgctcgccgat
gccggtgtccaaggaagcgaattggcgcatgcggacacggcgatccttttcagcgccgaa
tcggagtgggccacccgctccgagacgttgccgagcatgaaactcaaccattggcatgac
gtgcgtgactggtaccgcgcgttcctgaacgcgggtgcccgcgccgacatcgtgccgctt
gcctacgattggagttcatacaagaccatcgtcctgccgaccgtgctgatgctgagcgac
gccgatacgcgacggctggccggtttcgtacaggacggaggccgcgtggtggtcggttac
gcgaccggcctgctcgacgagcgcttccacacgtggctcggcggataccccggtgcgggc
gatggactgctgcgctcgatgctgggcgttcgtggcgaggaattcaacattctcggtacc
gagacggaagacgagccgagcgagattcggctggcatccaccggggattcgcccacgatg
gacggtgccgtgacccgcctgtggcagaacgacgtgaccgtcgccggaccgcatgtgcag
gtgcttgccgcgtatgccggcgaagaagcgaatgagtgggagcttgacggcacggccgcg
atcacccgcaacacgtacggcgaaggggaggcgtatttcctcggctgcgatctgggcgtg
agcgatctgacgcgattcgtgggaggctggcttgccgcgcgaccacaggatggccggcag
ccggaagccaacctgcggtcgcccgccagcggcgtgacctctgacgttctgcacaccgtg
cgtcaatccgacgacgccatattcgacttctatctgacacgtggcaaatcggatgtcgaa
ctgcgcgacatcgccggggagccgatcgtcctgttccgggcggaacggggcagtgacggc
ggcgcgtatacggtgcatcgcaatggcgttctcgtgatgaaacgcccgaacccgtcggtg
tag

DBGET integrated database retrieval system