KEGG   Bifidobacterium longum subsp. infantis ATCC 15697 (JGI): Blon_2141Help
Entry
Blon_2141         CDS       T00794                                 

Definition
Dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bln  Bifidobacterium longum subsp. infantis ATCC 15697 (JGI)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bln00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Blon_2141
   00670 One carbon pool by folate
    Blon_2141
Enzymes [BR:bln01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Blon_2141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2367056..2367610)
Genome map
AA seq 184 aa AA seqDB search
MNLIWAEARDKEGRAGAIGLNGGMPWHCAEDMKHFKELTVSHPVIMGRKTWESLGVKYRP
LPNRDNIVVSHDPMYRAPGATVVTSLDDALDMARQEAIPDDGLDRSEIWIIGGAQLFAEA
LPFADKAYVTDLAATVDADSYAPDMASLVEAGMWREAEVGEWHTPAKEESGIDSYRFRIL
AKTK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcttatctgggccgaagcccgcgacaaggaaggtcgcgccggtgccatcggcctc
aatggcggcatgccttggcactgtgccgaggatatgaagcatttcaaggagctgaccgtc
tcccatccggtgattatgggtcgtaagacttgggaatcgctgggggtcaagtaccggccg
ctgcccaaccgcgacaacatcgtcgtttcccacgatccgatgtaccgtgcgccgggggcc
actgtggtcaccagtcttgacgacgcgctcgatatggcccgtcaggaggcgattccggac
gacggtctggaccgttcggagatttggatcatcggcggtgcccagctgttcgccgaggct
ttgccgttcgcggacaaagcctatgtgactgatctggccgccaccgtggatgccgacagc
tacgcgcccgatatggcgtcgctggtcgaggccgggatgtggcgggaagccgaagtgggc
gagtggcatacgcccgccaaggaggagtccggcatcgattcctatcgtttccgtatcttg
gctaaaaccaagtga

DBGET integrated database retrieval system